Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177WF66

Protein Details
Accession A0A177WF66    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
55-81TKGGPNPPKKSRTKRFLKKLRKAMGVVHydrophilic
NLS Segment(s)
PositionSequence
57-77GGPNPPKKSRTKRFLKKLRKA
Subcellular Location(s) extr 12, mito 10, plas 3
Family & Domain DBs
Amino Acid Sequences MNLSLFFALALAVTTVNSVKIPSKASLDASITLEKRSPMPEGPHQQSTKTESPFTKGGPNPPKKSRTKRFLKKLRKAMGVVGRSMAGGLGKFLQQSSGVSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.07
4 0.07
5 0.08
6 0.1
7 0.12
8 0.15
9 0.16
10 0.19
11 0.2
12 0.22
13 0.24
14 0.23
15 0.22
16 0.22
17 0.24
18 0.21
19 0.2
20 0.2
21 0.17
22 0.17
23 0.17
24 0.17
25 0.16
26 0.2
27 0.27
28 0.34
29 0.37
30 0.42
31 0.41
32 0.4
33 0.39
34 0.41
35 0.38
36 0.32
37 0.31
38 0.25
39 0.28
40 0.28
41 0.27
42 0.27
43 0.24
44 0.31
45 0.38
46 0.47
47 0.5
48 0.55
49 0.62
50 0.65
51 0.75
52 0.75
53 0.75
54 0.78
55 0.82
56 0.86
57 0.89
58 0.91
59 0.9
60 0.9
61 0.88
62 0.83
63 0.73
64 0.7
65 0.68
66 0.59
67 0.49
68 0.4
69 0.32
70 0.26
71 0.25
72 0.17
73 0.09
74 0.07
75 0.07
76 0.08
77 0.09
78 0.09
79 0.09
80 0.1
81 0.1