Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177WUY2

Protein Details
Accession A0A177WUY2    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
77-102DEFQKKTRERWTRKLDKEKVKKKLQABasic
NLS Segment(s)
PositionSequence
82-99KTRERWTRKLDKEKVKKK
Subcellular Location(s) nucl 18, cyto_nucl 11.833, mito_nucl 11.333, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
Amino Acid Sequences MDALYNGGAIPSNEVSLQLCQYDMLHESFINIGNTEITPKCGTDGKSVAWVQSPTNNQFSINIKSILVNGKLVELPDEFQKKTRERWTRKLDKEKVKKKLQANSPMFKYNYNIKWEKLPTVSIVMFAQTPVTYDNSNSVVTIKLGPRDYMWKYDSEKCKYLTILDLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.14
4 0.15
5 0.11
6 0.11
7 0.11
8 0.11
9 0.12
10 0.13
11 0.12
12 0.12
13 0.12
14 0.12
15 0.13
16 0.15
17 0.14
18 0.12
19 0.11
20 0.11
21 0.11
22 0.14
23 0.13
24 0.14
25 0.14
26 0.14
27 0.15
28 0.18
29 0.21
30 0.22
31 0.25
32 0.22
33 0.28
34 0.28
35 0.27
36 0.26
37 0.24
38 0.2
39 0.23
40 0.26
41 0.23
42 0.26
43 0.25
44 0.23
45 0.25
46 0.28
47 0.26
48 0.24
49 0.22
50 0.19
51 0.19
52 0.2
53 0.2
54 0.17
55 0.13
56 0.11
57 0.11
58 0.12
59 0.11
60 0.11
61 0.08
62 0.08
63 0.12
64 0.15
65 0.14
66 0.18
67 0.24
68 0.25
69 0.31
70 0.4
71 0.45
72 0.5
73 0.59
74 0.66
75 0.7
76 0.77
77 0.82
78 0.81
79 0.82
80 0.85
81 0.84
82 0.83
83 0.81
84 0.8
85 0.75
86 0.75
87 0.73
88 0.73
89 0.7
90 0.67
91 0.62
92 0.6
93 0.54
94 0.47
95 0.41
96 0.39
97 0.37
98 0.38
99 0.37
100 0.32
101 0.38
102 0.39
103 0.4
104 0.33
105 0.29
106 0.24
107 0.26
108 0.24
109 0.19
110 0.17
111 0.15
112 0.13
113 0.12
114 0.11
115 0.07
116 0.08
117 0.08
118 0.1
119 0.1
120 0.1
121 0.13
122 0.15
123 0.15
124 0.15
125 0.14
126 0.13
127 0.13
128 0.17
129 0.17
130 0.2
131 0.21
132 0.22
133 0.23
134 0.3
135 0.32
136 0.34
137 0.33
138 0.32
139 0.36
140 0.45
141 0.52
142 0.51
143 0.53
144 0.5
145 0.52
146 0.48
147 0.45