Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177WIH7

Protein Details
Accession A0A177WIH7    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
122-141VPENTHHTVKSRKKTLNKLDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.333, cyto 12.5, nucl 12, cyto_pero 8.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
Amino Acid Sequences MFAQNPVTDENRNSVVEITLGPRDYMQILFAVQAGSDYYAVLGIPFMTRLGLTFDRAHKRIGFGPGCGCEVATDGYPIISNNDQVLWPLSHVRLPEQPSTSGSDGAFIRRRKPITTTDQVVVPENTHHTVKSRKKTLNKLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.17
4 0.17
5 0.15
6 0.15
7 0.15
8 0.14
9 0.14
10 0.14
11 0.15
12 0.14
13 0.12
14 0.09
15 0.09
16 0.09
17 0.09
18 0.08
19 0.06
20 0.06
21 0.06
22 0.06
23 0.06
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.04
30 0.03
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.05
37 0.1
38 0.1
39 0.13
40 0.16
41 0.22
42 0.28
43 0.29
44 0.31
45 0.26
46 0.28
47 0.28
48 0.33
49 0.27
50 0.22
51 0.23
52 0.22
53 0.23
54 0.2
55 0.17
56 0.09
57 0.09
58 0.09
59 0.07
60 0.06
61 0.05
62 0.05
63 0.06
64 0.05
65 0.07
66 0.07
67 0.07
68 0.07
69 0.08
70 0.07
71 0.08
72 0.1
73 0.08
74 0.08
75 0.09
76 0.1
77 0.11
78 0.11
79 0.14
80 0.17
81 0.21
82 0.24
83 0.24
84 0.25
85 0.25
86 0.3
87 0.28
88 0.25
89 0.21
90 0.2
91 0.18
92 0.23
93 0.28
94 0.25
95 0.28
96 0.33
97 0.36
98 0.35
99 0.39
100 0.41
101 0.43
102 0.5
103 0.5
104 0.45
105 0.45
106 0.44
107 0.43
108 0.36
109 0.28
110 0.23
111 0.22
112 0.23
113 0.22
114 0.21
115 0.23
116 0.33
117 0.42
118 0.5
119 0.55
120 0.61
121 0.7