Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177WNP7

Protein Details
Accession A0A177WNP7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-78IRCKDCGYRIMYKKRTKRSMHHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.5, nucl 11.5, mito 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006591  RNAP_P/RPABC4  
IPR039747  RPABC4  
IPR029040  RPABC4/Spt4  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF03604  DNA_RNApol_7kD  
Amino Acid Sequences MTLLDDASQNGRSCSPLIILLRLEVLTKQLISGQPRVDVEYTCGECTALNQIKPREPIRCKDCGYRIMYKKRTKRSMH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.17
4 0.17
5 0.18
6 0.18
7 0.16
8 0.16
9 0.15
10 0.15
11 0.1
12 0.1
13 0.08
14 0.08
15 0.08
16 0.09
17 0.12
18 0.15
19 0.18
20 0.17
21 0.18
22 0.19
23 0.2
24 0.18
25 0.15
26 0.15
27 0.16
28 0.16
29 0.14
30 0.14
31 0.12
32 0.11
33 0.12
34 0.18
35 0.17
36 0.18
37 0.23
38 0.26
39 0.3
40 0.35
41 0.38
42 0.39
43 0.41
44 0.48
45 0.49
46 0.54
47 0.53
48 0.56
49 0.58
50 0.56
51 0.57
52 0.59
53 0.62
54 0.66
55 0.72
56 0.74
57 0.78
58 0.81