Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2X9X5

Protein Details
Accession G2X9X5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
66-87LRAVPKKKTTHSKKRSRLMAGKBasic
NLS Segment(s)
PositionSequence
70-82PKKKTTHSKKRSR
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG vda:VDAG_07170  -  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MASIAASTTTSLLPRFSAATMLSSSRTWTMFAQQVTQPVLPRLSAALPAISLNIPGWLEGIWEGILRAVPKKKTTHSKKRSRLMAGKALQDVTSICKCPGCGQPKRKHVVCPHCMEQIKGMWRGANPSGKFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.14
5 0.12
6 0.14
7 0.15
8 0.15
9 0.16
10 0.15
11 0.16
12 0.16
13 0.16
14 0.15
15 0.15
16 0.18
17 0.21
18 0.21
19 0.23
20 0.22
21 0.25
22 0.26
23 0.27
24 0.23
25 0.2
26 0.2
27 0.16
28 0.15
29 0.13
30 0.11
31 0.11
32 0.1
33 0.08
34 0.08
35 0.08
36 0.08
37 0.07
38 0.07
39 0.05
40 0.06
41 0.06
42 0.05
43 0.06
44 0.05
45 0.05
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.08
55 0.12
56 0.14
57 0.18
58 0.21
59 0.27
60 0.37
61 0.47
62 0.56
63 0.62
64 0.71
65 0.77
66 0.82
67 0.83
68 0.8
69 0.77
70 0.72
71 0.71
72 0.64
73 0.57
74 0.5
75 0.43
76 0.35
77 0.28
78 0.22
79 0.18
80 0.17
81 0.15
82 0.15
83 0.15
84 0.15
85 0.19
86 0.27
87 0.31
88 0.39
89 0.48
90 0.57
91 0.66
92 0.74
93 0.73
94 0.73
95 0.74
96 0.75
97 0.73
98 0.71
99 0.66
100 0.66
101 0.64
102 0.56
103 0.5
104 0.46
105 0.44
106 0.4
107 0.37
108 0.31
109 0.31
110 0.36
111 0.38
112 0.4