Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177WNQ8

Protein Details
Accession A0A177WNQ8    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
83-104MYSHMIKQRRKYLGPKRSKKHABasic
NLS Segment(s)
PositionSequence
90-104QRRKYLGPKRSKKHA
Subcellular Location(s) mito 10, cyto 8, nucl 5, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007482  Tyr_Pase-like_PTPLA  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0016829  F:lyase activity  
GO:0006633  P:fatty acid biosynthetic process  
Pfam View protein in Pfam  
PF04387  PTPLA  
Amino Acid Sequences MVLAWSITEVVRYSYYALNLLAINPSALVWARYTFFYVLYPIGAGSELWLLMRSWDSARQYSTLLYYTLVGMAALYPPGFYVMYSHMIKQRRKYLGPKRSKKHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.15
5 0.14
6 0.13
7 0.13
8 0.12
9 0.1
10 0.09
11 0.07
12 0.07
13 0.06
14 0.07
15 0.07
16 0.07
17 0.08
18 0.09
19 0.09
20 0.11
21 0.11
22 0.11
23 0.11
24 0.11
25 0.1
26 0.09
27 0.08
28 0.06
29 0.06
30 0.06
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.05
37 0.04
38 0.04
39 0.05
40 0.05
41 0.06
42 0.1
43 0.12
44 0.13
45 0.14
46 0.15
47 0.15
48 0.15
49 0.15
50 0.12
51 0.11
52 0.1
53 0.09
54 0.08
55 0.08
56 0.07
57 0.06
58 0.05
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.06
66 0.06
67 0.05
68 0.07
69 0.1
70 0.16
71 0.17
72 0.19
73 0.24
74 0.32
75 0.37
76 0.44
77 0.5
78 0.52
79 0.58
80 0.66
81 0.71
82 0.75
83 0.81
84 0.83