Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168G157

Protein Details
Accession A0A168G157    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-32HQNPNFPKKAKTKNSRLILGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto 7, nucl 5, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021860  Peptidase_S12_Pab87-rel_C  
Pfam View protein in Pfam  
PF11954  DUF3471  
Amino Acid Sequences MGARGGMPTTTHHQNPNFPKKAKTKNSRLILGTSQEVPLTAYTGAYSNAGYHVVTVTIRGKKLFIDASDRSMGFILTFEHFKDQTKYIAYLTDVLEGGNEPVDAEFIFQNGRAVRQLGLDLEPAVRDLIWFDFLAAPASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.55
3 0.62
4 0.64
5 0.6
6 0.65
7 0.68
8 0.76
9 0.77
10 0.77
11 0.77
12 0.78
13 0.82
14 0.8
15 0.72
16 0.65
17 0.58
18 0.5
19 0.42
20 0.33
21 0.27
22 0.21
23 0.19
24 0.15
25 0.12
26 0.1
27 0.08
28 0.07
29 0.07
30 0.07
31 0.08
32 0.07
33 0.07
34 0.06
35 0.07
36 0.07
37 0.07
38 0.06
39 0.06
40 0.06
41 0.06
42 0.07
43 0.11
44 0.13
45 0.14
46 0.14
47 0.15
48 0.14
49 0.17
50 0.17
51 0.13
52 0.17
53 0.17
54 0.2
55 0.21
56 0.21
57 0.19
58 0.17
59 0.16
60 0.09
61 0.09
62 0.07
63 0.06
64 0.07
65 0.07
66 0.09
67 0.1
68 0.11
69 0.14
70 0.14
71 0.15
72 0.17
73 0.18
74 0.16
75 0.16
76 0.16
77 0.16
78 0.15
79 0.14
80 0.12
81 0.1
82 0.1
83 0.09
84 0.09
85 0.06
86 0.06
87 0.04
88 0.04
89 0.05
90 0.05
91 0.06
92 0.05
93 0.06
94 0.06
95 0.06
96 0.1
97 0.1
98 0.12
99 0.12
100 0.13
101 0.13
102 0.14
103 0.15
104 0.13
105 0.14
106 0.14
107 0.13
108 0.12
109 0.12
110 0.11
111 0.1
112 0.09
113 0.07
114 0.08
115 0.09
116 0.11
117 0.11
118 0.11
119 0.13
120 0.13