Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162IR27

Protein Details
Accession A0A162IR27    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
72-95AGPSEPPKKRLRPRTKIQRKTAAEHydrophilic
106-132AGPSTAPAQRRRKPRVKPKQETPVPLPHydrophilic
NLS Segment(s)
PositionSequence
77-93PPKKRLRPRTKIQRKTA
111-124APAQRRRKPRVKPK
Subcellular Location(s) mito 16, nucl 8, cyto 2
Family & Domain DBs
Amino Acid Sequences MAKVTAATPPAAAPLKVRFCEPVLGLPPLFPRDQQQNGAGEKKQQQQQKQKQMAHTPLPPVPEATSEGPTEAGPSEPPKKRLRPRTKIQRKTAAESAAAAGAAATAGPSTAPAQRRRKPRVKPKQETPVPLPVPGGVTTASSSAAAAGKPDEQQGASKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.31
4 0.32
5 0.3
6 0.3
7 0.33
8 0.31
9 0.29
10 0.27
11 0.29
12 0.27
13 0.26
14 0.27
15 0.26
16 0.25
17 0.2
18 0.2
19 0.25
20 0.29
21 0.31
22 0.32
23 0.34
24 0.37
25 0.4
26 0.37
27 0.35
28 0.38
29 0.42
30 0.44
31 0.45
32 0.51
33 0.58
34 0.67
35 0.72
36 0.75
37 0.72
38 0.72
39 0.74
40 0.71
41 0.64
42 0.57
43 0.5
44 0.43
45 0.4
46 0.34
47 0.27
48 0.22
49 0.18
50 0.18
51 0.16
52 0.16
53 0.14
54 0.14
55 0.14
56 0.13
57 0.12
58 0.09
59 0.07
60 0.06
61 0.1
62 0.17
63 0.2
64 0.25
65 0.3
66 0.39
67 0.47
68 0.58
69 0.65
70 0.66
71 0.74
72 0.81
73 0.86
74 0.87
75 0.86
76 0.85
77 0.78
78 0.75
79 0.68
80 0.59
81 0.47
82 0.38
83 0.31
84 0.21
85 0.17
86 0.11
87 0.06
88 0.04
89 0.04
90 0.03
91 0.02
92 0.02
93 0.02
94 0.02
95 0.03
96 0.05
97 0.09
98 0.15
99 0.24
100 0.34
101 0.41
102 0.52
103 0.61
104 0.69
105 0.75
106 0.81
107 0.84
108 0.86
109 0.89
110 0.88
111 0.9
112 0.87
113 0.84
114 0.78
115 0.76
116 0.66
117 0.57
118 0.48
119 0.38
120 0.33
121 0.26
122 0.22
123 0.12
124 0.12
125 0.12
126 0.12
127 0.12
128 0.09
129 0.09
130 0.09
131 0.1
132 0.09
133 0.09
134 0.11
135 0.12
136 0.13
137 0.15
138 0.15
139 0.15