Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168GPG3

Protein Details
Accession A0A168GPG3   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-54IACSKSLYKATQKRRNKKRELADFAHKPSVRRRSTTQARRPRRILNHydrophilic
NLS Segment(s)
PositionSequence
21-50KRRNKKRELADFAHKPSVRRRSTTQARRPR
Subcellular Location(s) mito 12, nucl 6, cyto 5, extr 4
Family & Domain DBs
Amino Acid Sequences MASIIIVVIACSKSLYKATQKRRNKKRELADFAHKPSVRRRSTTQARRPRRILNSTSSSSGGGGGGYNSTTYNSNGLVPRPDEPFELTSPSDLADLESLTRASTIASESGHSRRRMSDESTLAEVARDGAWTART
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.19
3 0.27
4 0.37
5 0.48
6 0.57
7 0.68
8 0.77
9 0.85
10 0.9
11 0.9
12 0.9
13 0.89
14 0.9
15 0.87
16 0.83
17 0.82
18 0.77
19 0.72
20 0.71
21 0.62
22 0.53
23 0.53
24 0.56
25 0.5
26 0.49
27 0.49
28 0.51
29 0.6
30 0.69
31 0.71
32 0.71
33 0.77
34 0.81
35 0.8
36 0.78
37 0.75
38 0.71
39 0.65
40 0.61
41 0.57
42 0.51
43 0.48
44 0.41
45 0.33
46 0.26
47 0.22
48 0.15
49 0.09
50 0.07
51 0.05
52 0.04
53 0.04
54 0.04
55 0.04
56 0.05
57 0.06
58 0.06
59 0.07
60 0.08
61 0.1
62 0.11
63 0.12
64 0.13
65 0.13
66 0.14
67 0.16
68 0.16
69 0.15
70 0.17
71 0.18
72 0.17
73 0.19
74 0.17
75 0.15
76 0.14
77 0.14
78 0.11
79 0.09
80 0.09
81 0.06
82 0.06
83 0.06
84 0.07
85 0.07
86 0.06
87 0.06
88 0.06
89 0.05
90 0.06
91 0.07
92 0.07
93 0.08
94 0.09
95 0.13
96 0.2
97 0.26
98 0.28
99 0.28
100 0.3
101 0.36
102 0.39
103 0.41
104 0.42
105 0.4
106 0.42
107 0.43
108 0.41
109 0.34
110 0.3
111 0.25
112 0.18
113 0.14
114 0.1
115 0.08