Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2X427

Protein Details
Accession G2X427   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-30NSTNPRPQPRRGPQPARTASHydrophilic
79-101LLTPSGKKQPPKRSPSQAPSQRRHydrophilic
NLS Segment(s)
PositionSequence
89-91PKR
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
KEGG vda:VDAG_04764  -  
Amino Acid Sequences MPSNSYPHRANSTNPRPQPRRGPQPARTASPSSSANGQGKKPSDGAGAQMNQTLSITMMTTPVNPVPFPLPIPLGIAMLLTPSGKKQPPKRSPSQAPSQRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.7
3 0.68
4 0.73
5 0.77
6 0.76
7 0.77
8 0.77
9 0.8
10 0.76
11 0.82
12 0.8
13 0.74
14 0.69
15 0.61
16 0.51
17 0.46
18 0.39
19 0.3
20 0.28
21 0.27
22 0.27
23 0.27
24 0.27
25 0.28
26 0.28
27 0.29
28 0.27
29 0.23
30 0.2
31 0.17
32 0.18
33 0.17
34 0.16
35 0.14
36 0.15
37 0.14
38 0.12
39 0.11
40 0.1
41 0.06
42 0.05
43 0.05
44 0.04
45 0.05
46 0.05
47 0.06
48 0.07
49 0.08
50 0.09
51 0.09
52 0.1
53 0.11
54 0.11
55 0.12
56 0.12
57 0.12
58 0.11
59 0.13
60 0.12
61 0.11
62 0.1
63 0.09
64 0.07
65 0.07
66 0.07
67 0.05
68 0.05
69 0.07
70 0.13
71 0.18
72 0.27
73 0.37
74 0.48
75 0.58
76 0.66
77 0.74
78 0.78
79 0.84
80 0.83
81 0.85