Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162J5U7

Protein Details
Accession A0A162J5U7    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
57-77LIGKGKKGKKLTQKGGSKRFGBasic
NLS Segment(s)
PositionSequence
59-77GKGKKGKKLTQKGGSKRFG
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MSGKPKAAKVAHTKRQASKINKVTNKQSKDKLNKKFTSGLTAKTEQLLGERAGHLELIGKGKKGKKLTQKGGSKRFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.75
3 0.76
4 0.72
5 0.72
6 0.72
7 0.73
8 0.73
9 0.71
10 0.72
11 0.72
12 0.72
13 0.68
14 0.66
15 0.66
16 0.7
17 0.74
18 0.74
19 0.75
20 0.7
21 0.67
22 0.66
23 0.57
24 0.55
25 0.47
26 0.41
27 0.35
28 0.35
29 0.31
30 0.26
31 0.25
32 0.17
33 0.17
34 0.15
35 0.11
36 0.1
37 0.1
38 0.1
39 0.1
40 0.1
41 0.09
42 0.09
43 0.1
44 0.15
45 0.16
46 0.17
47 0.22
48 0.27
49 0.34
50 0.38
51 0.45
52 0.51
53 0.6
54 0.69
55 0.74
56 0.79
57 0.83