Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2WSN0

Protein Details
Accession G2WSN0   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MIRPSWKRQRKEIRKTREQTGLPHydrophilic
59-81FVAKPPMCRKRRKAEAKTGMRSSHydrophilic
NLS Segment(s)
PositionSequence
68-72KRRKA
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
KEGG vda:VDAG_01626  -  
Amino Acid Sequences MIRPSWKRQRKEIRKTREQTGLPLVKQNCPPFCCTLGRHGGRHGLAPCIVCASPLQRVFVAKPPMCRKRRKAEAKTGMRSSHRHQCRDKIMDALRLPTRCILDCLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.84
4 0.81
5 0.72
6 0.65
7 0.65
8 0.61
9 0.51
10 0.53
11 0.47
12 0.43
13 0.47
14 0.48
15 0.44
16 0.39
17 0.42
18 0.38
19 0.39
20 0.38
21 0.33
22 0.33
23 0.37
24 0.39
25 0.37
26 0.35
27 0.37
28 0.33
29 0.36
30 0.3
31 0.22
32 0.2
33 0.19
34 0.17
35 0.14
36 0.13
37 0.1
38 0.09
39 0.09
40 0.13
41 0.14
42 0.15
43 0.13
44 0.14
45 0.16
46 0.22
47 0.29
48 0.25
49 0.32
50 0.4
51 0.49
52 0.55
53 0.63
54 0.64
55 0.66
56 0.76
57 0.79
58 0.79
59 0.8
60 0.84
61 0.85
62 0.85
63 0.79
64 0.73
65 0.66
66 0.62
67 0.57
68 0.57
69 0.55
70 0.56
71 0.57
72 0.61
73 0.66
74 0.67
75 0.63
76 0.61
77 0.58
78 0.58
79 0.53
80 0.51
81 0.48
82 0.43
83 0.42
84 0.38
85 0.37
86 0.31