Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168FFA8

Protein Details
Accession A0A168FFA8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
70-94ELLKFRESAKHRRRHNRADSASPSFHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, plas 7, E.R. 4, mito 3, golg 2
Family & Domain DBs
Amino Acid Sequences MMLAIKSIAAMVLVLATAALAAPGNINRGETLTIDMGAPLPTTFLTDSGPPPPEPTTAQPPEDIWGIWAELLKFRESAKHRRRHNRADSASPSFELDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.02
5 0.02
6 0.02
7 0.02
8 0.02
9 0.04
10 0.05
11 0.07
12 0.07
13 0.08
14 0.08
15 0.09
16 0.1
17 0.09
18 0.11
19 0.09
20 0.1
21 0.09
22 0.09
23 0.09
24 0.08
25 0.07
26 0.05
27 0.05
28 0.05
29 0.06
30 0.06
31 0.06
32 0.07
33 0.08
34 0.09
35 0.11
36 0.13
37 0.12
38 0.14
39 0.14
40 0.15
41 0.16
42 0.18
43 0.24
44 0.25
45 0.26
46 0.25
47 0.24
48 0.24
49 0.23
50 0.19
51 0.11
52 0.09
53 0.08
54 0.08
55 0.09
56 0.07
57 0.1
58 0.12
59 0.12
60 0.12
61 0.13
62 0.21
63 0.25
64 0.36
65 0.43
66 0.5
67 0.6
68 0.7
69 0.8
70 0.83
71 0.88
72 0.87
73 0.84
74 0.84
75 0.81
76 0.77
77 0.7
78 0.6