Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168GZK0

Protein Details
Accession A0A168GZK0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
72-92VLMNGLKWRQKRERNEKKEHIHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, mito 6, E.R. 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASSNNCINLVLVDTNQGQAGTAMAASNIAKCLIGAGATAATVPLINSIGAGPAFAAIGSAYFICCIPLTAVLMNGLKWRQKRERNEKKEHI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.12
5 0.1
6 0.08
7 0.08
8 0.06
9 0.05
10 0.04
11 0.04
12 0.05
13 0.05
14 0.05
15 0.06
16 0.06
17 0.05
18 0.05
19 0.06
20 0.05
21 0.05
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.02
45 0.03
46 0.03
47 0.03
48 0.03
49 0.04
50 0.04
51 0.05
52 0.05
53 0.06
54 0.06
55 0.07
56 0.09
57 0.08
58 0.09
59 0.11
60 0.11
61 0.11
62 0.14
63 0.16
64 0.2
65 0.24
66 0.33
67 0.41
68 0.5
69 0.61
70 0.69
71 0.77
72 0.82