Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A167Q6H7

Protein Details
Accession A0A167Q6H7    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
68-91GEWQKMKKKVKVRAKRAADRKGVMBasic
NLS Segment(s)
PositionSequence
72-107KMKKKVKVRAKRAADRKGVMCAKGAKGAKGAQRKQG
Subcellular Location(s) cyto 13, cyto_nucl 11.5, nucl 8, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
CDD cd00024  CD_CSD  
Amino Acid Sequences MSAEDLGSQAQHEAIASDNAQYSNLEQEWEVEKIIGEETKAGKLYYMVKWAPSLVVEEDMRNAAEVVGEWQKMKKKVKVRAKRAADRKGVMCAKGAKGAKGAQRKQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.09
4 0.09
5 0.11
6 0.11
7 0.12
8 0.11
9 0.11
10 0.13
11 0.13
12 0.12
13 0.11
14 0.13
15 0.15
16 0.16
17 0.15
18 0.11
19 0.11
20 0.1
21 0.11
22 0.09
23 0.07
24 0.08
25 0.09
26 0.11
27 0.11
28 0.11
29 0.1
30 0.11
31 0.15
32 0.14
33 0.18
34 0.16
35 0.16
36 0.17
37 0.17
38 0.15
39 0.12
40 0.11
41 0.07
42 0.09
43 0.09
44 0.09
45 0.09
46 0.09
47 0.09
48 0.08
49 0.07
50 0.05
51 0.04
52 0.04
53 0.07
54 0.08
55 0.09
56 0.09
57 0.13
58 0.19
59 0.26
60 0.32
61 0.37
62 0.44
63 0.54
64 0.64
65 0.72
66 0.76
67 0.79
68 0.83
69 0.86
70 0.86
71 0.85
72 0.81
73 0.75
74 0.67
75 0.66
76 0.6
77 0.51
78 0.46
79 0.41
80 0.36
81 0.39
82 0.39
83 0.31
84 0.31
85 0.36
86 0.4
87 0.46