Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2WT30

Protein Details
Accession G2WT30    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
75-103HTAVREYRRRRSRLARSPRHKTRNLKSVDBasic
NLS Segment(s)
PositionSequence
82-97RRRRSRLARSPRHKTR
Subcellular Location(s) plas 25
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG vda:VDAG_00953  -  
Amino Acid Sequences MAMSILAIIILLLNWIISVGAYLSMTNILIPSVLEASLRLIQRTYWPIVRAFALAVGFLFSCTLRLILFFTIDIHTAVREYRRRRSRLARSPRHKTRNLKSVDLRDTEAVTEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.04
8 0.04
9 0.05
10 0.05
11 0.05
12 0.06
13 0.05
14 0.05
15 0.04
16 0.04
17 0.04
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.08
24 0.12
25 0.12
26 0.12
27 0.11
28 0.12
29 0.16
30 0.19
31 0.19
32 0.18
33 0.19
34 0.19
35 0.2
36 0.2
37 0.17
38 0.13
39 0.11
40 0.09
41 0.07
42 0.06
43 0.05
44 0.05
45 0.04
46 0.05
47 0.03
48 0.04
49 0.04
50 0.05
51 0.04
52 0.05
53 0.06
54 0.06
55 0.07
56 0.06
57 0.07
58 0.08
59 0.08
60 0.09
61 0.07
62 0.07
63 0.07
64 0.09
65 0.14
66 0.21
67 0.26
68 0.36
69 0.45
70 0.49
71 0.57
72 0.66
73 0.71
74 0.74
75 0.8
76 0.81
77 0.82
78 0.89
79 0.91
80 0.9
81 0.88
82 0.87
83 0.86
84 0.84
85 0.8
86 0.78
87 0.75
88 0.75
89 0.73
90 0.66
91 0.59
92 0.52
93 0.47