Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168K110

Protein Details
Accession A0A168K110    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
122-159STAANKPRDGKKGKKRSSKPGKREPKPDLRKRTWDVVEBasic
NLS Segment(s)
PositionSequence
127-153KPRDGKKGKKRSSKPGKREPKPDLRKR
Subcellular Location(s) nucl 19, cyto_nucl 12.833, mito_nucl 10.833, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024526  DUF3807  
Pfam View protein in Pfam  
PF12720  DUF3807  
Amino Acid Sequences MPNHDTQQHQAFKLPNILPDELAGFHGAHFSSAALSSFQKDFVLPNSQATLCEGEDAEDWEEEDDLGYYEDGVKRTLTDEQIEIFRHSELRELERAKEKASKLHQSEVSSGEPGTPGIQPNSTAANKPRDGKKGKKRSSKPGKREPKPDLRKRTWDVVEAGLDSLDYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.37
3 0.37
4 0.37
5 0.32
6 0.29
7 0.27
8 0.19
9 0.19
10 0.15
11 0.11
12 0.09
13 0.11
14 0.1
15 0.09
16 0.08
17 0.08
18 0.07
19 0.08
20 0.08
21 0.08
22 0.09
23 0.11
24 0.11
25 0.12
26 0.12
27 0.11
28 0.12
29 0.14
30 0.2
31 0.18
32 0.19
33 0.21
34 0.21
35 0.21
36 0.21
37 0.19
38 0.13
39 0.13
40 0.11
41 0.1
42 0.1
43 0.11
44 0.11
45 0.08
46 0.08
47 0.08
48 0.08
49 0.07
50 0.06
51 0.05
52 0.04
53 0.05
54 0.04
55 0.04
56 0.06
57 0.07
58 0.08
59 0.09
60 0.08
61 0.08
62 0.1
63 0.12
64 0.12
65 0.11
66 0.11
67 0.11
68 0.13
69 0.14
70 0.14
71 0.12
72 0.11
73 0.11
74 0.1
75 0.13
76 0.12
77 0.14
78 0.18
79 0.19
80 0.21
81 0.28
82 0.28
83 0.27
84 0.31
85 0.29
86 0.31
87 0.36
88 0.42
89 0.38
90 0.43
91 0.44
92 0.41
93 0.42
94 0.38
95 0.33
96 0.25
97 0.23
98 0.17
99 0.13
100 0.12
101 0.11
102 0.09
103 0.09
104 0.1
105 0.1
106 0.11
107 0.12
108 0.17
109 0.17
110 0.2
111 0.23
112 0.29
113 0.32
114 0.37
115 0.43
116 0.46
117 0.53
118 0.6
119 0.66
120 0.7
121 0.77
122 0.82
123 0.83
124 0.86
125 0.9
126 0.9
127 0.89
128 0.89
129 0.9
130 0.88
131 0.9
132 0.88
133 0.88
134 0.88
135 0.88
136 0.88
137 0.85
138 0.86
139 0.82
140 0.82
141 0.74
142 0.68
143 0.6
144 0.54
145 0.47
146 0.38
147 0.33
148 0.23