Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162K5L3

Protein Details
Accession A0A162K5L3    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
91-117EKLAEKMHKKRVERLKRKEKRNKLISSBasic
NLS Segment(s)
PositionSequence
58-114KENEMKTEKKEARQRKVDAIREKRAKKAEKERYEKLAEKMHKKRVERLKRKEKRNKL
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MTEPTSLSEVTQAEKPLGMRKNGKQWHAPKKAFRPTAGLTTYEKRTKERALMTQMKAKENEMKTEKKEARQRKVDAIREKRAKKAEKERYEKLAEKMHKKRVERLKRKEKRNKLISS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.23
4 0.27
5 0.31
6 0.35
7 0.4
8 0.5
9 0.54
10 0.57
11 0.59
12 0.64
13 0.69
14 0.72
15 0.72
16 0.7
17 0.74
18 0.79
19 0.73
20 0.65
21 0.6
22 0.52
23 0.53
24 0.46
25 0.38
26 0.32
27 0.33
28 0.37
29 0.35
30 0.34
31 0.3
32 0.33
33 0.33
34 0.35
35 0.35
36 0.35
37 0.39
38 0.45
39 0.45
40 0.46
41 0.45
42 0.42
43 0.38
44 0.34
45 0.33
46 0.26
47 0.31
48 0.3
49 0.31
50 0.31
51 0.41
52 0.42
53 0.42
54 0.51
55 0.54
56 0.58
57 0.63
58 0.63
59 0.63
60 0.69
61 0.7
62 0.71
63 0.7
64 0.71
65 0.72
66 0.71
67 0.69
68 0.69
69 0.68
70 0.67
71 0.7
72 0.71
73 0.72
74 0.77
75 0.76
76 0.74
77 0.73
78 0.68
79 0.62
80 0.61
81 0.58
82 0.61
83 0.64
84 0.67
85 0.68
86 0.67
87 0.72
88 0.74
89 0.77
90 0.78
91 0.8
92 0.82
93 0.84
94 0.92
95 0.94
96 0.94
97 0.93