Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2X681

Protein Details
Accession G2X681    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MAGQRVTYRRRNPYNTRSNRTRIIKHydrophilic
61-83SRRWTRLGRRLHNKPRRTRTHLTBasic
NLS Segment(s)
PositionSequence
68-77GRRLHNKPRR
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG vda:VDAG_05663  -  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAGQRVTYRRRNPYNTRSNRTRIIKTPGGAHRVLHVKKRGTAPKCGDCGTKLPGVSSSHDSRRWTRLGRRLHNKPRRTRTHLTPSSIPALRPREYSQISKPQKTVQRAYGGSRCGNCVRDRVVRAFLIEEQKIVKKVLKEAGQSEKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.86
4 0.84
5 0.8
6 0.8
7 0.78
8 0.74
9 0.69
10 0.67
11 0.64
12 0.57
13 0.6
14 0.56
15 0.53
16 0.47
17 0.41
18 0.38
19 0.42
20 0.43
21 0.42
22 0.43
23 0.41
24 0.45
25 0.54
26 0.57
27 0.51
28 0.58
29 0.58
30 0.58
31 0.58
32 0.54
33 0.47
34 0.4
35 0.4
36 0.34
37 0.29
38 0.22
39 0.2
40 0.21
41 0.22
42 0.22
43 0.24
44 0.24
45 0.26
46 0.29
47 0.32
48 0.32
49 0.34
50 0.36
51 0.36
52 0.4
53 0.43
54 0.49
55 0.56
56 0.62
57 0.68
58 0.75
59 0.79
60 0.8
61 0.81
62 0.82
63 0.81
64 0.8
65 0.76
66 0.74
67 0.75
68 0.72
69 0.67
70 0.59
71 0.53
72 0.5
73 0.45
74 0.36
75 0.32
76 0.32
77 0.29
78 0.29
79 0.29
80 0.31
81 0.34
82 0.37
83 0.37
84 0.43
85 0.48
86 0.48
87 0.48
88 0.48
89 0.52
90 0.54
91 0.53
92 0.48
93 0.49
94 0.47
95 0.51
96 0.49
97 0.45
98 0.43
99 0.39
100 0.37
101 0.33
102 0.34
103 0.3
104 0.3
105 0.32
106 0.35
107 0.38
108 0.38
109 0.39
110 0.36
111 0.36
112 0.34
113 0.33
114 0.32
115 0.29
116 0.26
117 0.25
118 0.28
119 0.29
120 0.29
121 0.28
122 0.24
123 0.3
124 0.37
125 0.39
126 0.4
127 0.44
128 0.53