Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168DQH9

Protein Details
Accession A0A168DQH9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-77AGKFKPSTPKRKAKGRSTGLHydrophilic
NLS Segment(s)
PositionSequence
52-76MKKGGAAGKFKPSTPKRKAKGRSTG
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR042831  YmL28  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MTSTHSITRLFGGLSLLPTSTPRTTTTMLSNTARSFATTPASLARKATPQMMKKGGAAGKFKPSTPKRKAKGRSTGLTESAKKVRTLKQNMFAPAPPPLRMARQRHLRHWTIHRAWQLFRRQQHEAQHKERSRMQAGMWNACEALRTATGPGDRGEGYLYRVAMEKKGVWNGDAIPIEYARMQTETPAAEAWNHEWKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.13
4 0.12
5 0.13
6 0.17
7 0.17
8 0.17
9 0.18
10 0.22
11 0.24
12 0.27
13 0.31
14 0.3
15 0.34
16 0.34
17 0.35
18 0.3
19 0.3
20 0.28
21 0.23
22 0.21
23 0.18
24 0.19
25 0.16
26 0.16
27 0.2
28 0.23
29 0.22
30 0.22
31 0.22
32 0.23
33 0.24
34 0.3
35 0.32
36 0.34
37 0.41
38 0.43
39 0.42
40 0.39
41 0.43
42 0.39
43 0.36
44 0.35
45 0.3
46 0.35
47 0.34
48 0.35
49 0.39
50 0.43
51 0.49
52 0.55
53 0.63
54 0.61
55 0.7
56 0.78
57 0.77
58 0.81
59 0.77
60 0.73
61 0.7
62 0.66
63 0.6
64 0.56
65 0.48
66 0.41
67 0.38
68 0.34
69 0.29
70 0.3
71 0.33
72 0.37
73 0.44
74 0.45
75 0.49
76 0.52
77 0.52
78 0.5
79 0.44
80 0.35
81 0.34
82 0.3
83 0.22
84 0.2
85 0.19
86 0.22
87 0.29
88 0.33
89 0.35
90 0.44
91 0.47
92 0.52
93 0.58
94 0.56
95 0.54
96 0.55
97 0.57
98 0.5
99 0.52
100 0.5
101 0.46
102 0.45
103 0.46
104 0.48
105 0.45
106 0.47
107 0.46
108 0.45
109 0.48
110 0.55
111 0.58
112 0.57
113 0.57
114 0.62
115 0.6
116 0.6
117 0.6
118 0.56
119 0.5
120 0.43
121 0.38
122 0.34
123 0.34
124 0.34
125 0.31
126 0.25
127 0.22
128 0.2
129 0.2
130 0.14
131 0.13
132 0.09
133 0.09
134 0.09
135 0.12
136 0.13
137 0.14
138 0.13
139 0.14
140 0.13
141 0.13
142 0.14
143 0.12
144 0.14
145 0.15
146 0.15
147 0.13
148 0.16
149 0.16
150 0.16
151 0.19
152 0.19
153 0.21
154 0.27
155 0.27
156 0.24
157 0.25
158 0.24
159 0.28
160 0.26
161 0.22
162 0.18
163 0.18
164 0.18
165 0.17
166 0.17
167 0.12
168 0.13
169 0.12
170 0.12
171 0.15
172 0.15
173 0.16
174 0.16
175 0.15
176 0.14
177 0.17
178 0.2