Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A167SD67

Protein Details
Accession A0A167SD67    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
145-175QGKPARPSRPPQQQHKKKKRPASQLQLCCCFHydrophilic
NLS Segment(s)
PositionSequence
121-165RPSKPPGKRPGGGASGTPIYPPGFQGKPARPSRPPQQQHKKKKRP
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018306  Phage_T5_Orf172_DNA-bd  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF10544  T5orf172  
Amino Acid Sequences MPFVANTPESLLARSDSKDPKSTCRGITSSGRPCRRPLAAATRYGGGRHLTAILDDDPADESLYCWQHKEQASHSAASSPGPKGSSGYAAVPTIREERTSLDTLADRLGLVDIGDKYSAARPSKPPGKRPGGGASGTPIYPPGFQGKPARPSRPPQQQHKKKKRPASQLQLCCCFSIPIEQVEDEPAEKPKPKPSNQPYQQEPMPTYQPQRPSTASYSSHYRPPSSKYCRPPMPSPAKSSKSETSVTAQLKHLIPNSLDAATASLLMAELVRPVTESDEPGYIYMFWLVQEPDSNSTQPRAPVEAARSLLAPPSSSSPARGRRASDTVSRYASQSHRDGRPGKQTMLLKIGRAANVQRRMNQWQRQCGYDIEVLRYYPYASSSSPTPTPSLGRHRRGSDSPPTAAAGIMTPHAKRVERLVHIELTGMGFRAEKETCKACGRDHREWFEVASTRDDVRKVDEVIRRWTEWDCREE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.32
4 0.36
5 0.44
6 0.46
7 0.52
8 0.58
9 0.62
10 0.58
11 0.57
12 0.54
13 0.52
14 0.57
15 0.58
16 0.6
17 0.64
18 0.67
19 0.63
20 0.65
21 0.66
22 0.61
23 0.55
24 0.53
25 0.54
26 0.52
27 0.55
28 0.53
29 0.49
30 0.46
31 0.43
32 0.37
33 0.28
34 0.23
35 0.19
36 0.18
37 0.15
38 0.14
39 0.17
40 0.15
41 0.14
42 0.13
43 0.12
44 0.12
45 0.12
46 0.13
47 0.09
48 0.09
49 0.14
50 0.19
51 0.19
52 0.19
53 0.2
54 0.27
55 0.32
56 0.36
57 0.33
58 0.39
59 0.41
60 0.41
61 0.4
62 0.35
63 0.3
64 0.28
65 0.29
66 0.2
67 0.19
68 0.19
69 0.18
70 0.18
71 0.19
72 0.2
73 0.17
74 0.18
75 0.17
76 0.17
77 0.17
78 0.16
79 0.17
80 0.18
81 0.17
82 0.16
83 0.16
84 0.18
85 0.23
86 0.25
87 0.23
88 0.21
89 0.22
90 0.22
91 0.21
92 0.18
93 0.12
94 0.1
95 0.1
96 0.07
97 0.06
98 0.09
99 0.08
100 0.09
101 0.09
102 0.09
103 0.1
104 0.14
105 0.2
106 0.19
107 0.23
108 0.26
109 0.35
110 0.45
111 0.5
112 0.54
113 0.58
114 0.64
115 0.61
116 0.62
117 0.59
118 0.54
119 0.49
120 0.42
121 0.35
122 0.28
123 0.26
124 0.21
125 0.16
126 0.12
127 0.12
128 0.13
129 0.15
130 0.14
131 0.18
132 0.26
133 0.31
134 0.39
135 0.45
136 0.5
137 0.49
138 0.55
139 0.61
140 0.64
141 0.66
142 0.68
143 0.73
144 0.78
145 0.85
146 0.9
147 0.91
148 0.89
149 0.92
150 0.9
151 0.9
152 0.89
153 0.89
154 0.88
155 0.85
156 0.82
157 0.78
158 0.68
159 0.58
160 0.48
161 0.37
162 0.27
163 0.24
164 0.2
165 0.15
166 0.16
167 0.16
168 0.15
169 0.16
170 0.16
171 0.11
172 0.11
173 0.11
174 0.12
175 0.15
176 0.17
177 0.25
178 0.33
179 0.36
180 0.46
181 0.51
182 0.6
183 0.65
184 0.7
185 0.65
186 0.62
187 0.6
188 0.51
189 0.45
190 0.37
191 0.33
192 0.29
193 0.28
194 0.27
195 0.32
196 0.32
197 0.34
198 0.32
199 0.33
200 0.33
201 0.35
202 0.33
203 0.28
204 0.32
205 0.3
206 0.34
207 0.31
208 0.3
209 0.27
210 0.3
211 0.38
212 0.41
213 0.47
214 0.49
215 0.56
216 0.6
217 0.63
218 0.61
219 0.61
220 0.63
221 0.58
222 0.57
223 0.57
224 0.55
225 0.52
226 0.53
227 0.46
228 0.39
229 0.37
230 0.32
231 0.27
232 0.3
233 0.29
234 0.27
235 0.24
236 0.24
237 0.24
238 0.24
239 0.22
240 0.17
241 0.16
242 0.16
243 0.17
244 0.13
245 0.12
246 0.1
247 0.1
248 0.08
249 0.08
250 0.06
251 0.04
252 0.04
253 0.04
254 0.04
255 0.03
256 0.03
257 0.03
258 0.03
259 0.04
260 0.04
261 0.07
262 0.07
263 0.08
264 0.09
265 0.1
266 0.1
267 0.1
268 0.1
269 0.08
270 0.07
271 0.07
272 0.06
273 0.05
274 0.07
275 0.07
276 0.07
277 0.08
278 0.1
279 0.12
280 0.14
281 0.15
282 0.14
283 0.16
284 0.17
285 0.17
286 0.17
287 0.17
288 0.17
289 0.19
290 0.21
291 0.23
292 0.22
293 0.21
294 0.2
295 0.17
296 0.17
297 0.15
298 0.12
299 0.09
300 0.12
301 0.15
302 0.15
303 0.19
304 0.24
305 0.33
306 0.38
307 0.4
308 0.39
309 0.41
310 0.45
311 0.45
312 0.45
313 0.41
314 0.39
315 0.4
316 0.37
317 0.33
318 0.33
319 0.33
320 0.3
321 0.32
322 0.35
323 0.35
324 0.41
325 0.45
326 0.45
327 0.52
328 0.51
329 0.46
330 0.46
331 0.46
332 0.42
333 0.47
334 0.42
335 0.32
336 0.33
337 0.34
338 0.29
339 0.29
340 0.31
341 0.31
342 0.39
343 0.42
344 0.41
345 0.43
346 0.51
347 0.58
348 0.6
349 0.59
350 0.6
351 0.59
352 0.57
353 0.54
354 0.47
355 0.42
356 0.4
357 0.34
358 0.28
359 0.27
360 0.25
361 0.23
362 0.22
363 0.18
364 0.14
365 0.14
366 0.13
367 0.12
368 0.14
369 0.16
370 0.2
371 0.21
372 0.23
373 0.22
374 0.22
375 0.25
376 0.29
377 0.38
378 0.43
379 0.49
380 0.54
381 0.56
382 0.6
383 0.61
384 0.62
385 0.61
386 0.57
387 0.51
388 0.46
389 0.43
390 0.37
391 0.32
392 0.26
393 0.16
394 0.11
395 0.12
396 0.13
397 0.12
398 0.16
399 0.2
400 0.21
401 0.21
402 0.28
403 0.34
404 0.36
405 0.42
406 0.43
407 0.41
408 0.4
409 0.39
410 0.32
411 0.26
412 0.21
413 0.15
414 0.11
415 0.1
416 0.1
417 0.14
418 0.15
419 0.16
420 0.21
421 0.24
422 0.29
423 0.35
424 0.37
425 0.39
426 0.49
427 0.55
428 0.6
429 0.65
430 0.67
431 0.63
432 0.62
433 0.57
434 0.52
435 0.48
436 0.4
437 0.35
438 0.31
439 0.31
440 0.33
441 0.33
442 0.28
443 0.29
444 0.32
445 0.31
446 0.36
447 0.41
448 0.42
449 0.5
450 0.53
451 0.49
452 0.46
453 0.48
454 0.49