Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XK19

Protein Details
Accession G2XK19   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
63-85HASPGVKALKRRRPNKKLVATMEHydrophilic
NLS Segment(s)
PositionSequence
66-79PGVKALKRRRPNKK
109-128RVRHKSLKSRPGALKRKEKV
Subcellular Location(s) mito 21, cyto_mito 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR028160  Slx9-like  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0030688  C:preribosome, small subunit precursor  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG vda:VDAG_10501  -  
Pfam View protein in Pfam  
PF15341  SLX9  
Amino Acid Sequences MAPTAPPKMSARAARLARISGAMHPLAPTKTHRAEANVPDGFLSTKKDKRVMKHSGFVSKINHASPGVKALKRRRPNKKLVATMESLADALPELTNEADGNVAQLRQGRVRHKSLKSRPGALKRKEKVVRGEMARFGASMAALVATPEATAAAENQTMAVEDTTDTPAAPAPATTNRWAALRRHISTTMEQNPAFTGQGAGKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.43
4 0.37
5 0.33
6 0.3
7 0.23
8 0.25
9 0.21
10 0.18
11 0.18
12 0.2
13 0.19
14 0.2
15 0.22
16 0.25
17 0.29
18 0.32
19 0.32
20 0.35
21 0.41
22 0.44
23 0.48
24 0.41
25 0.37
26 0.34
27 0.32
28 0.28
29 0.21
30 0.22
31 0.21
32 0.25
33 0.29
34 0.36
35 0.4
36 0.47
37 0.55
38 0.6
39 0.58
40 0.6
41 0.6
42 0.61
43 0.58
44 0.54
45 0.48
46 0.42
47 0.4
48 0.33
49 0.3
50 0.24
51 0.23
52 0.19
53 0.24
54 0.25
55 0.24
56 0.31
57 0.39
58 0.48
59 0.56
60 0.66
61 0.69
62 0.73
63 0.81
64 0.84
65 0.83
66 0.81
67 0.76
68 0.71
69 0.61
70 0.53
71 0.43
72 0.33
73 0.24
74 0.16
75 0.11
76 0.06
77 0.05
78 0.04
79 0.03
80 0.03
81 0.03
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.05
91 0.07
92 0.08
93 0.12
94 0.16
95 0.21
96 0.26
97 0.33
98 0.4
99 0.45
100 0.54
101 0.59
102 0.64
103 0.62
104 0.64
105 0.65
106 0.67
107 0.71
108 0.69
109 0.71
110 0.64
111 0.71
112 0.68
113 0.65
114 0.62
115 0.57
116 0.56
117 0.5
118 0.5
119 0.42
120 0.39
121 0.34
122 0.27
123 0.21
124 0.15
125 0.11
126 0.08
127 0.05
128 0.04
129 0.04
130 0.04
131 0.04
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.04
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.07
145 0.07
146 0.07
147 0.05
148 0.06
149 0.08
150 0.09
151 0.1
152 0.09
153 0.09
154 0.1
155 0.1
156 0.1
157 0.08
158 0.1
159 0.16
160 0.2
161 0.22
162 0.23
163 0.24
164 0.26
165 0.3
166 0.3
167 0.34
168 0.4
169 0.4
170 0.43
171 0.45
172 0.46
173 0.47
174 0.53
175 0.5
176 0.47
177 0.44
178 0.4
179 0.39
180 0.37
181 0.32
182 0.23
183 0.19