Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162N5T8

Protein Details
Accession A0A162N5T8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
42-67DEKFDTNQRREQQRKKKKRKHDGRGEBasic
NLS Segment(s)
PositionSequence
52-67EQQRKKKKRKHDGRGE
Subcellular Location(s) extr 17, E.R. 4, mito 3, plas 1, pero 1, golg 1
Family & Domain DBs
Amino Acid Sequences MKATAIAATVLLAAVAVASSAATQDGASVRCVGEACGPIVGDEKFDTNQRREQQRKKKKRKHDGRGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.02
4 0.02
5 0.02
6 0.02
7 0.02
8 0.03
9 0.03
10 0.03
11 0.04
12 0.06
13 0.07
14 0.08
15 0.08
16 0.08
17 0.08
18 0.09
19 0.08
20 0.09
21 0.08
22 0.08
23 0.08
24 0.08
25 0.07
26 0.09
27 0.09
28 0.08
29 0.08
30 0.09
31 0.1
32 0.15
33 0.2
34 0.22
35 0.29
36 0.36
37 0.46
38 0.55
39 0.65
40 0.71
41 0.78
42 0.86
43 0.9
44 0.93
45 0.94
46 0.95
47 0.96