Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168C727

Protein Details
Accession A0A168C727    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAAGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
6-22GAKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 11, mito 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAGAKKQKKKWSKGKVKDKAQHAVILDKSTSEKLYKDVQSYRLVTVAVLVDRMKINGSLARQCITDLEEKGLIKPITTHSKMKIYTRAIAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.92
5 0.92
6 0.93
7 0.9
8 0.85
9 0.82
10 0.72
11 0.65
12 0.55
13 0.5
14 0.41
15 0.35
16 0.28
17 0.2
18 0.2
19 0.17
20 0.17
21 0.13
22 0.12
23 0.13
24 0.2
25 0.22
26 0.24
27 0.26
28 0.28
29 0.31
30 0.32
31 0.3
32 0.24
33 0.22
34 0.17
35 0.15
36 0.12
37 0.08
38 0.07
39 0.06
40 0.07
41 0.07
42 0.08
43 0.07
44 0.07
45 0.08
46 0.09
47 0.12
48 0.15
49 0.16
50 0.17
51 0.16
52 0.16
53 0.16
54 0.16
55 0.18
56 0.16
57 0.17
58 0.19
59 0.19
60 0.2
61 0.26
62 0.23
63 0.19
64 0.2
65 0.23
66 0.3
67 0.34
68 0.38
69 0.36
70 0.44
71 0.47
72 0.51
73 0.54
74 0.49