Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168C959

Protein Details
Accession A0A168C959    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
80-110GNGGVTRPKRGWKRKRKSRWRGFGWPERLKPBasic
NLS Segment(s)
PositionSequence
64-110RRRRARKAAVSAKKNMGNGGVTRPKRGWKRKRKSRWRGFGWPERLKP
Subcellular Location(s) mito 9, cyto 8, plas 5, mito_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYIPHDYQLYLKRASATTAGSGIAAGGIAAKNSGGDERSTRFILGFGIGVPILLILIGAVWYFRRRRARKAAVSAKKNMGNGGVTRPKRGWKRKRKSRWRGFGWPERLKPVPAPAAYRKSDKDILPTML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.22
4 0.19
5 0.18
6 0.17
7 0.14
8 0.13
9 0.11
10 0.08
11 0.06
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.05
20 0.06
21 0.06
22 0.07
23 0.1
24 0.13
25 0.16
26 0.17
27 0.17
28 0.16
29 0.15
30 0.14
31 0.12
32 0.1
33 0.06
34 0.06
35 0.06
36 0.05
37 0.05
38 0.04
39 0.03
40 0.03
41 0.02
42 0.01
43 0.02
44 0.02
45 0.02
46 0.02
47 0.03
48 0.06
49 0.07
50 0.14
51 0.24
52 0.27
53 0.35
54 0.45
55 0.54
56 0.58
57 0.67
58 0.72
59 0.7
60 0.72
61 0.69
62 0.63
63 0.57
64 0.5
65 0.41
66 0.31
67 0.24
68 0.21
69 0.24
70 0.28
71 0.26
72 0.28
73 0.29
74 0.36
75 0.45
76 0.55
77 0.59
78 0.61
79 0.72
80 0.81
81 0.9
82 0.94
83 0.95
84 0.95
85 0.95
86 0.92
87 0.91
88 0.89
89 0.88
90 0.87
91 0.84
92 0.76
93 0.71
94 0.65
95 0.56
96 0.5
97 0.46
98 0.43
99 0.37
100 0.4
101 0.42
102 0.48
103 0.49
104 0.52
105 0.49
106 0.49
107 0.52
108 0.47
109 0.47