Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168KHN4

Protein Details
Accession A0A168KHN4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
291-310RTSKRGYSGRSERRRRMFGSBasic
NLS Segment(s)
Subcellular Location(s) extr 23, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR028000  Pma1  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF14610  Psg1  
Amino Acid Sequences MLSSAIVGAIALCGAASAAVAAPPVAAITPAPVLHRRDPAGELDPWVSVNEDPSATTFTPSWTTDGEGKTSLKDAAPSSLTGSVFSFTTLAEPTTTTGDPPNPTASNNKGSGAFSLCSKKDSSIEPFCRPRVNSTLEPGNVYYLTWDPEHYADKSNESYALTVQVKQQNRTTKEWVFLSDFDNTQVPAKQGYFPFAVNDGLLDGHDSNNITVTLQRRLNNTIGNPDDVTTEYPLIVAKFKYPAKAPNNGATGHTLTIALPVVFGTILLLVVGMCLWNRKTRRIQLGELMSRTSKRGYSGRSERRRRMFGSGAAADADHDIQLGNGFPDDGPEYHDAPANGARRHRADSDGLDSLTTSPVHGSFQQQGTTGGRNAFRDELDRQHNERTGGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.04
7 0.04
8 0.04
9 0.04
10 0.04
11 0.05
12 0.04
13 0.05
14 0.04
15 0.06
16 0.08
17 0.1
18 0.13
19 0.19
20 0.25
21 0.29
22 0.35
23 0.35
24 0.36
25 0.37
26 0.39
27 0.38
28 0.34
29 0.31
30 0.26
31 0.25
32 0.22
33 0.21
34 0.17
35 0.13
36 0.13
37 0.12
38 0.11
39 0.11
40 0.12
41 0.17
42 0.16
43 0.17
44 0.16
45 0.16
46 0.2
47 0.2
48 0.21
49 0.17
50 0.2
51 0.23
52 0.24
53 0.24
54 0.24
55 0.23
56 0.22
57 0.23
58 0.22
59 0.17
60 0.19
61 0.17
62 0.18
63 0.19
64 0.18
65 0.19
66 0.21
67 0.21
68 0.19
69 0.18
70 0.15
71 0.14
72 0.14
73 0.11
74 0.07
75 0.09
76 0.08
77 0.08
78 0.08
79 0.08
80 0.09
81 0.13
82 0.13
83 0.12
84 0.14
85 0.18
86 0.19
87 0.2
88 0.24
89 0.21
90 0.23
91 0.27
92 0.29
93 0.31
94 0.3
95 0.29
96 0.26
97 0.26
98 0.26
99 0.24
100 0.2
101 0.18
102 0.23
103 0.22
104 0.22
105 0.22
106 0.22
107 0.21
108 0.25
109 0.29
110 0.33
111 0.38
112 0.44
113 0.48
114 0.49
115 0.51
116 0.48
117 0.45
118 0.42
119 0.43
120 0.38
121 0.37
122 0.41
123 0.36
124 0.37
125 0.32
126 0.27
127 0.2
128 0.18
129 0.15
130 0.1
131 0.11
132 0.1
133 0.1
134 0.1
135 0.12
136 0.14
137 0.14
138 0.18
139 0.17
140 0.19
141 0.2
142 0.19
143 0.18
144 0.16
145 0.15
146 0.11
147 0.16
148 0.14
149 0.14
150 0.19
151 0.24
152 0.26
153 0.28
154 0.33
155 0.36
156 0.4
157 0.44
158 0.45
159 0.41
160 0.42
161 0.4
162 0.37
163 0.3
164 0.27
165 0.24
166 0.2
167 0.18
168 0.15
169 0.15
170 0.13
171 0.12
172 0.12
173 0.1
174 0.1
175 0.11
176 0.13
177 0.13
178 0.15
179 0.15
180 0.14
181 0.14
182 0.14
183 0.13
184 0.1
185 0.09
186 0.07
187 0.05
188 0.05
189 0.05
190 0.05
191 0.05
192 0.06
193 0.06
194 0.05
195 0.06
196 0.06
197 0.06
198 0.08
199 0.1
200 0.15
201 0.18
202 0.21
203 0.22
204 0.26
205 0.28
206 0.28
207 0.27
208 0.27
209 0.25
210 0.24
211 0.21
212 0.18
213 0.17
214 0.15
215 0.16
216 0.11
217 0.1
218 0.08
219 0.08
220 0.08
221 0.08
222 0.09
223 0.08
224 0.09
225 0.14
226 0.15
227 0.17
228 0.19
229 0.28
230 0.3
231 0.38
232 0.39
233 0.4
234 0.41
235 0.4
236 0.39
237 0.32
238 0.29
239 0.22
240 0.19
241 0.13
242 0.1
243 0.11
244 0.1
245 0.07
246 0.06
247 0.05
248 0.05
249 0.05
250 0.05
251 0.04
252 0.03
253 0.03
254 0.03
255 0.03
256 0.03
257 0.03
258 0.03
259 0.03
260 0.03
261 0.06
262 0.07
263 0.14
264 0.17
265 0.25
266 0.33
267 0.42
268 0.52
269 0.55
270 0.57
271 0.57
272 0.64
273 0.61
274 0.54
275 0.48
276 0.39
277 0.35
278 0.33
279 0.28
280 0.2
281 0.2
282 0.24
283 0.27
284 0.35
285 0.45
286 0.54
287 0.63
288 0.71
289 0.76
290 0.79
291 0.81
292 0.74
293 0.71
294 0.65
295 0.59
296 0.57
297 0.48
298 0.41
299 0.34
300 0.31
301 0.24
302 0.2
303 0.15
304 0.07
305 0.06
306 0.06
307 0.05
308 0.06
309 0.06
310 0.06
311 0.05
312 0.06
313 0.06
314 0.08
315 0.1
316 0.1
317 0.14
318 0.17
319 0.18
320 0.19
321 0.22
322 0.2
323 0.2
324 0.26
325 0.29
326 0.29
327 0.31
328 0.36
329 0.37
330 0.42
331 0.41
332 0.39
333 0.38
334 0.38
335 0.4
336 0.38
337 0.34
338 0.3
339 0.28
340 0.25
341 0.22
342 0.18
343 0.12
344 0.1
345 0.11
346 0.14
347 0.15
348 0.19
349 0.23
350 0.26
351 0.27
352 0.27
353 0.3
354 0.3
355 0.32
356 0.31
357 0.29
358 0.3
359 0.3
360 0.33
361 0.32
362 0.3
363 0.31
364 0.32
365 0.35
366 0.41
367 0.46
368 0.46
369 0.51
370 0.54