Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162KF66

Protein Details
Accession A0A162KF66    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
54-78HSSVKKRCEHCKVVRRKAGKRHNGYBasic
NLS Segment(s)
Subcellular Location(s) mito 23.5, mito_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MASIFRTMTLSARALCPRALFAATPSSVLSPFSRALAATTITSTQQQIRGMKVHSSVKKRCEHCKVVRRKAGKRHNGYLYIICKANPRHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.22
4 0.2
5 0.2
6 0.2
7 0.15
8 0.14
9 0.18
10 0.17
11 0.17
12 0.16
13 0.15
14 0.14
15 0.15
16 0.14
17 0.12
18 0.12
19 0.12
20 0.11
21 0.1
22 0.11
23 0.11
24 0.11
25 0.08
26 0.09
27 0.09
28 0.09
29 0.1
30 0.1
31 0.1
32 0.12
33 0.15
34 0.15
35 0.16
36 0.18
37 0.19
38 0.19
39 0.22
40 0.26
41 0.29
42 0.36
43 0.4
44 0.45
45 0.52
46 0.55
47 0.6
48 0.61
49 0.64
50 0.66
51 0.71
52 0.75
53 0.77
54 0.81
55 0.81
56 0.81
57 0.82
58 0.82
59 0.83
60 0.8
61 0.78
62 0.77
63 0.72
64 0.67
65 0.64
66 0.56
67 0.49
68 0.42
69 0.35
70 0.35
71 0.38
72 0.45
73 0.48
74 0.54