Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168AWN3

Protein Details
Accession A0A168AWN3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
20-41ASSARIKKNKKAQNIKFKVRCQHydrophilic
NLS Segment(s)
PositionSequence
23-31ARIKKNKKA
Subcellular Location(s) nucl 18.5, cyto_nucl 13, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPREVADIKKFIEICRRKDASSARIKKNKKAQNIKFKVRCQKHLYTLVLKDTEKAEKLKQSLPPTLQITDVSKKSTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.48
3 0.5
4 0.45
5 0.51
6 0.54
7 0.53
8 0.57
9 0.6
10 0.6
11 0.67
12 0.7
13 0.71
14 0.75
15 0.73
16 0.72
17 0.74
18 0.74
19 0.76
20 0.81
21 0.83
22 0.8
23 0.8
24 0.8
25 0.73
26 0.71
27 0.66
28 0.63
29 0.59
30 0.59
31 0.55
32 0.5
33 0.47
34 0.43
35 0.39
36 0.34
37 0.29
38 0.24
39 0.24
40 0.22
41 0.23
42 0.23
43 0.26
44 0.3
45 0.33
46 0.38
47 0.4
48 0.45
49 0.44
50 0.47
51 0.45
52 0.43
53 0.39
54 0.35
55 0.35
56 0.35
57 0.35