Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162LK12

Protein Details
Accession A0A162LK12    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
496-516FDPDQPRPKQTTHRLRKQVRFHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR005322  Peptidase_C69  
Gene Ontology GO:0070004  F:cysteine-type exopeptidase activity  
GO:0016805  F:dipeptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF03577  Peptidase_C69  
Amino Acid Sequences MLPLLHTLCLAAPAAASYAFYVGKDLTADNAVLVGGTGEEVSSHWLQLFPARDHPPNATVTVGVTAAAVIPGELITIPEVRHTYRYMSMEYSDYEGFPAPLTNGGLNEKGVAVRDVWASNRDELADMTPTPQRGVQYADLARLVMERADTARHGVQIVGDLIKKHGYATYGGNTHLIADKDEGWVVWEFAGGKGLWAAERLKTDEVRVLYPGYIENFPTNYTSSSDYMGSDNLVSFAVEQGWWNASSGQPFNIFNVYGMQGNVTARNGGFKYMSQADLEEATLAMVPLTETKLMERVRDHRISDDEAGYGQVVRLHADIEPNLLRIWNAPTGAVAAPFIPWWLGVDSIPPEYSEHRYLTTGASSSFLHPDFQLQEASGFAGRMFKRVLYYMCSAPDTFLQLVTEMLTAFEAQSMQDVSWVEKAARALLDGGDGPAATRLLTHYAHTRADKAMQLGRTMTDALDGWVKLSGGWKGPTGSEINDAGEGAETVNCLVGFDPDQPRPKQTTHRLRKQVRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.07
5 0.09
6 0.09
7 0.09
8 0.11
9 0.1
10 0.11
11 0.12
12 0.11
13 0.11
14 0.13
15 0.13
16 0.11
17 0.11
18 0.1
19 0.08
20 0.08
21 0.05
22 0.04
23 0.04
24 0.04
25 0.03
26 0.04
27 0.04
28 0.1
29 0.1
30 0.11
31 0.11
32 0.12
33 0.12
34 0.18
35 0.23
36 0.21
37 0.29
38 0.34
39 0.37
40 0.4
41 0.43
42 0.41
43 0.37
44 0.36
45 0.28
46 0.23
47 0.2
48 0.19
49 0.15
50 0.11
51 0.09
52 0.07
53 0.07
54 0.06
55 0.05
56 0.04
57 0.04
58 0.03
59 0.04
60 0.04
61 0.04
62 0.06
63 0.07
64 0.08
65 0.11
66 0.13
67 0.15
68 0.18
69 0.19
70 0.21
71 0.26
72 0.28
73 0.28
74 0.28
75 0.28
76 0.27
77 0.26
78 0.26
79 0.21
80 0.18
81 0.17
82 0.15
83 0.14
84 0.12
85 0.12
86 0.08
87 0.1
88 0.11
89 0.1
90 0.11
91 0.13
92 0.14
93 0.13
94 0.13
95 0.12
96 0.11
97 0.11
98 0.11
99 0.09
100 0.1
101 0.12
102 0.13
103 0.14
104 0.17
105 0.18
106 0.19
107 0.19
108 0.17
109 0.16
110 0.16
111 0.16
112 0.15
113 0.12
114 0.13
115 0.15
116 0.15
117 0.15
118 0.16
119 0.15
120 0.14
121 0.19
122 0.18
123 0.23
124 0.23
125 0.24
126 0.22
127 0.22
128 0.2
129 0.16
130 0.14
131 0.08
132 0.07
133 0.06
134 0.07
135 0.08
136 0.09
137 0.11
138 0.12
139 0.12
140 0.13
141 0.12
142 0.11
143 0.12
144 0.12
145 0.11
146 0.11
147 0.11
148 0.11
149 0.12
150 0.12
151 0.11
152 0.11
153 0.11
154 0.12
155 0.14
156 0.17
157 0.18
158 0.18
159 0.18
160 0.17
161 0.16
162 0.17
163 0.14
164 0.11
165 0.11
166 0.11
167 0.12
168 0.12
169 0.11
170 0.1
171 0.1
172 0.09
173 0.07
174 0.07
175 0.07
176 0.07
177 0.09
178 0.07
179 0.06
180 0.07
181 0.07
182 0.06
183 0.08
184 0.09
185 0.09
186 0.11
187 0.13
188 0.15
189 0.15
190 0.16
191 0.18
192 0.18
193 0.17
194 0.17
195 0.15
196 0.13
197 0.13
198 0.13
199 0.11
200 0.11
201 0.11
202 0.11
203 0.1
204 0.11
205 0.12
206 0.12
207 0.11
208 0.12
209 0.14
210 0.13
211 0.14
212 0.14
213 0.13
214 0.13
215 0.12
216 0.11
217 0.08
218 0.07
219 0.06
220 0.06
221 0.05
222 0.04
223 0.05
224 0.05
225 0.04
226 0.05
227 0.05
228 0.06
229 0.06
230 0.06
231 0.06
232 0.07
233 0.09
234 0.09
235 0.1
236 0.11
237 0.11
238 0.11
239 0.12
240 0.11
241 0.09
242 0.1
243 0.1
244 0.08
245 0.08
246 0.07
247 0.07
248 0.08
249 0.08
250 0.07
251 0.07
252 0.06
253 0.09
254 0.09
255 0.09
256 0.09
257 0.08
258 0.12
259 0.13
260 0.14
261 0.11
262 0.11
263 0.11
264 0.11
265 0.11
266 0.07
267 0.06
268 0.05
269 0.05
270 0.04
271 0.03
272 0.03
273 0.03
274 0.03
275 0.04
276 0.05
277 0.05
278 0.05
279 0.11
280 0.12
281 0.14
282 0.17
283 0.21
284 0.28
285 0.31
286 0.32
287 0.29
288 0.31
289 0.32
290 0.31
291 0.27
292 0.2
293 0.16
294 0.16
295 0.13
296 0.1
297 0.07
298 0.07
299 0.06
300 0.07
301 0.07
302 0.07
303 0.08
304 0.09
305 0.09
306 0.11
307 0.11
308 0.11
309 0.11
310 0.1
311 0.1
312 0.1
313 0.12
314 0.11
315 0.11
316 0.1
317 0.1
318 0.12
319 0.12
320 0.11
321 0.08
322 0.06
323 0.06
324 0.06
325 0.06
326 0.04
327 0.04
328 0.05
329 0.06
330 0.06
331 0.06
332 0.08
333 0.09
334 0.11
335 0.11
336 0.1
337 0.11
338 0.13
339 0.18
340 0.19
341 0.19
342 0.19
343 0.2
344 0.2
345 0.2
346 0.19
347 0.15
348 0.12
349 0.13
350 0.12
351 0.13
352 0.15
353 0.14
354 0.14
355 0.13
356 0.16
357 0.15
358 0.16
359 0.15
360 0.12
361 0.12
362 0.11
363 0.12
364 0.1
365 0.08
366 0.07
367 0.14
368 0.14
369 0.16
370 0.16
371 0.16
372 0.17
373 0.2
374 0.22
375 0.19
376 0.23
377 0.23
378 0.24
379 0.25
380 0.23
381 0.22
382 0.21
383 0.2
384 0.17
385 0.15
386 0.13
387 0.12
388 0.12
389 0.11
390 0.11
391 0.07
392 0.07
393 0.06
394 0.06
395 0.06
396 0.06
397 0.06
398 0.05
399 0.07
400 0.07
401 0.07
402 0.09
403 0.1
404 0.11
405 0.13
406 0.14
407 0.13
408 0.14
409 0.15
410 0.15
411 0.15
412 0.13
413 0.12
414 0.11
415 0.12
416 0.1
417 0.1
418 0.08
419 0.08
420 0.07
421 0.08
422 0.08
423 0.06
424 0.06
425 0.07
426 0.11
427 0.12
428 0.14
429 0.19
430 0.23
431 0.29
432 0.3
433 0.31
434 0.3
435 0.32
436 0.33
437 0.31
438 0.33
439 0.29
440 0.3
441 0.28
442 0.26
443 0.24
444 0.22
445 0.18
446 0.14
447 0.12
448 0.12
449 0.15
450 0.14
451 0.13
452 0.13
453 0.13
454 0.12
455 0.15
456 0.17
457 0.18
458 0.19
459 0.21
460 0.21
461 0.21
462 0.24
463 0.23
464 0.22
465 0.22
466 0.21
467 0.21
468 0.19
469 0.19
470 0.16
471 0.14
472 0.12
473 0.09
474 0.08
475 0.07
476 0.07
477 0.08
478 0.08
479 0.08
480 0.08
481 0.09
482 0.11
483 0.17
484 0.24
485 0.29
486 0.37
487 0.39
488 0.45
489 0.48
490 0.52
491 0.56
492 0.61
493 0.65
494 0.69
495 0.78
496 0.83