Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165DNM2

Protein Details
Accession A0A165DNM2    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-27KETTTGRKRGTKKDKDAPKRGLSBasic
NLS Segment(s)
PositionSequence
11-24RKRGTKKDKDAPKR
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MPKVKETTTGRKRGTKKDKDAPKRGLSAYLIFSNEWRDRVKAENPDASFGDIGRLLGAKWKELPDNEKKEYQRKSDEDKERAAKEKAAYEVKKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.79
4 0.79
5 0.84
6 0.86
7 0.89
8 0.86
9 0.8
10 0.74
11 0.65
12 0.59
13 0.5
14 0.42
15 0.35
16 0.29
17 0.25
18 0.19
19 0.19
20 0.21
21 0.21
22 0.2
23 0.19
24 0.17
25 0.18
26 0.22
27 0.27
28 0.28
29 0.3
30 0.33
31 0.32
32 0.34
33 0.32
34 0.29
35 0.23
36 0.17
37 0.14
38 0.08
39 0.08
40 0.06
41 0.05
42 0.04
43 0.09
44 0.1
45 0.1
46 0.12
47 0.13
48 0.16
49 0.18
50 0.25
51 0.3
52 0.38
53 0.4
54 0.45
55 0.48
56 0.55
57 0.59
58 0.59
59 0.58
60 0.56
61 0.61
62 0.64
63 0.7
64 0.66
65 0.68
66 0.68
67 0.64
68 0.64
69 0.58
70 0.52
71 0.46
72 0.46
73 0.45
74 0.47
75 0.45