Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165I100

Protein Details
Accession A0A165I100    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
29-56LSGFNVPHSKHKTKRKWLPNVHNKWLFSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 4.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034704  L28p-like  
IPR026569  Ribo_L28/L24  
IPR037147  Ribo_L28/L24_sf  
IPR001383  Ribosomal_L28  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00830  Ribosomal_L28  
Amino Acid Sequences MFPTFPRLLFKIKHLPGPTTQLFEGRNTLSGFNVPHSKHKTKRKWLPNVHNKWLFSEALGGTVKVRLTASTLRTIDKYGGLDAYMLRSRHLEAFRKMGGSAMALRIRIREAEKAKVDKVLAEELQKIAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.45
4 0.51
5 0.45
6 0.39
7 0.37
8 0.33
9 0.32
10 0.3
11 0.3
12 0.23
13 0.24
14 0.21
15 0.21
16 0.17
17 0.18
18 0.17
19 0.17
20 0.23
21 0.21
22 0.28
23 0.36
24 0.43
25 0.5
26 0.6
27 0.67
28 0.71
29 0.8
30 0.82
31 0.85
32 0.87
33 0.9
34 0.9
35 0.88
36 0.86
37 0.8
38 0.7
39 0.62
40 0.54
41 0.43
42 0.32
43 0.26
44 0.17
45 0.14
46 0.14
47 0.12
48 0.09
49 0.1
50 0.1
51 0.08
52 0.08
53 0.05
54 0.08
55 0.11
56 0.13
57 0.18
58 0.19
59 0.19
60 0.2
61 0.21
62 0.19
63 0.17
64 0.16
65 0.1
66 0.1
67 0.09
68 0.09
69 0.08
70 0.11
71 0.13
72 0.13
73 0.13
74 0.14
75 0.15
76 0.2
77 0.26
78 0.28
79 0.27
80 0.32
81 0.33
82 0.33
83 0.31
84 0.27
85 0.22
86 0.17
87 0.16
88 0.16
89 0.17
90 0.17
91 0.17
92 0.17
93 0.18
94 0.2
95 0.21
96 0.24
97 0.27
98 0.34
99 0.41
100 0.45
101 0.45
102 0.46
103 0.43
104 0.37
105 0.36
106 0.34
107 0.29
108 0.27
109 0.28