Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165D586

Protein Details
Accession A0A165D586    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
301-336LGRTRPRPPGCRKKMGTLRPLRRRRRTGGRRCPVSABasic
NLS Segment(s)
PositionSequence
301-331LGRTRPRPPGCRKKMGTLRPLRRRRRTGGRR
Subcellular Location(s) cyto 11.5, cyto_nucl 10, mito 6, nucl 5.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR003903  UIM_dom  
PROSITE View protein in PROSITE  
PS50330  UIM  
Amino Acid Sequences MRLRDILSSYLDPAPTPEPELEAAEAEGAYEEAVAEAIAAQAVADVTGEPVEPLYASAPAPAQGGFMFMNPDELDTAPIPGAGIGLSYEQQAAEAEAELVLEAVEQAVAQAEEEADIQQAVEEALEEAVAEAVIEQVIEQAVEDAIEDALEEAIEVRPFCSSALSGVLTGFVVCFFYRLPQCQEAPGRSTGPRTGTTANCRTLESCTRPSAPRACTRRRTPRSSLLRSWCPLRSPLSRVLRHAGAGGRAAAQGAVWRAASAGSVAAPRAKVASAAAGAATAVRAGASAVVEEGRTAPAPGLGRTRPRPPGCRKKMGTLRPLRRRRRTGGRRCPVSAVVLRGARVRAVGSGVTAGVGVKAGAGASLGGVGVGSLGDAVVRASGAGVGRPVKGVGSSVVGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.21
3 0.23
4 0.2
5 0.19
6 0.2
7 0.22
8 0.2
9 0.17
10 0.16
11 0.14
12 0.13
13 0.1
14 0.09
15 0.07
16 0.06
17 0.05
18 0.04
19 0.04
20 0.04
21 0.04
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.04
32 0.04
33 0.04
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.08
43 0.08
44 0.09
45 0.09
46 0.1
47 0.11
48 0.1
49 0.1
50 0.08
51 0.11
52 0.1
53 0.1
54 0.11
55 0.1
56 0.12
57 0.11
58 0.12
59 0.11
60 0.11
61 0.13
62 0.12
63 0.13
64 0.1
65 0.1
66 0.09
67 0.08
68 0.08
69 0.05
70 0.04
71 0.04
72 0.05
73 0.05
74 0.06
75 0.06
76 0.06
77 0.07
78 0.07
79 0.07
80 0.06
81 0.06
82 0.06
83 0.05
84 0.06
85 0.05
86 0.05
87 0.04
88 0.03
89 0.03
90 0.02
91 0.02
92 0.02
93 0.02
94 0.03
95 0.03
96 0.03
97 0.04
98 0.04
99 0.04
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.04
106 0.04
107 0.04
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.02
119 0.03
120 0.03
121 0.02
122 0.02
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.04
141 0.05
142 0.05
143 0.05
144 0.06
145 0.06
146 0.06
147 0.06
148 0.06
149 0.06
150 0.08
151 0.08
152 0.08
153 0.08
154 0.08
155 0.07
156 0.06
157 0.05
158 0.04
159 0.04
160 0.04
161 0.05
162 0.04
163 0.08
164 0.1
165 0.13
166 0.17
167 0.19
168 0.2
169 0.24
170 0.27
171 0.25
172 0.26
173 0.26
174 0.24
175 0.22
176 0.23
177 0.21
178 0.2
179 0.2
180 0.2
181 0.21
182 0.22
183 0.28
184 0.31
185 0.32
186 0.29
187 0.29
188 0.27
189 0.27
190 0.3
191 0.28
192 0.27
193 0.26
194 0.28
195 0.29
196 0.32
197 0.35
198 0.33
199 0.37
200 0.41
201 0.47
202 0.52
203 0.6
204 0.68
205 0.69
206 0.73
207 0.7
208 0.72
209 0.74
210 0.73
211 0.72
212 0.67
213 0.65
214 0.59
215 0.57
216 0.48
217 0.4
218 0.35
219 0.33
220 0.3
221 0.29
222 0.36
223 0.42
224 0.42
225 0.43
226 0.44
227 0.39
228 0.35
229 0.33
230 0.26
231 0.18
232 0.16
233 0.14
234 0.11
235 0.1
236 0.1
237 0.08
238 0.06
239 0.07
240 0.07
241 0.07
242 0.06
243 0.06
244 0.06
245 0.06
246 0.06
247 0.05
248 0.05
249 0.05
250 0.05
251 0.06
252 0.07
253 0.07
254 0.07
255 0.08
256 0.08
257 0.07
258 0.07
259 0.08
260 0.07
261 0.07
262 0.07
263 0.06
264 0.06
265 0.06
266 0.05
267 0.03
268 0.03
269 0.02
270 0.03
271 0.03
272 0.03
273 0.04
274 0.04
275 0.04
276 0.05
277 0.05
278 0.05
279 0.06
280 0.06
281 0.07
282 0.07
283 0.07
284 0.1
285 0.11
286 0.13
287 0.18
288 0.2
289 0.28
290 0.32
291 0.39
292 0.46
293 0.51
294 0.59
295 0.64
296 0.72
297 0.73
298 0.8
299 0.76
300 0.77
301 0.8
302 0.8
303 0.79
304 0.79
305 0.8
306 0.81
307 0.88
308 0.88
309 0.89
310 0.88
311 0.87
312 0.87
313 0.88
314 0.88
315 0.89
316 0.89
317 0.85
318 0.8
319 0.75
320 0.65
321 0.61
322 0.53
323 0.46
324 0.41
325 0.36
326 0.34
327 0.32
328 0.31
329 0.25
330 0.22
331 0.18
332 0.13
333 0.14
334 0.13
335 0.11
336 0.11
337 0.1
338 0.09
339 0.09
340 0.08
341 0.06
342 0.06
343 0.05
344 0.04
345 0.04
346 0.04
347 0.04
348 0.04
349 0.04
350 0.03
351 0.04
352 0.04
353 0.03
354 0.03
355 0.03
356 0.03
357 0.03
358 0.03
359 0.02
360 0.02
361 0.02
362 0.03
363 0.03
364 0.03
365 0.03
366 0.04
367 0.04
368 0.06
369 0.07
370 0.08
371 0.12
372 0.14
373 0.15
374 0.16
375 0.16
376 0.15
377 0.15
378 0.15
379 0.13