Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165EJT3

Protein Details
Accession A0A165EJT3    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
110-138SVPNRRPMTTRRRRNIRRREKTPPQAGLNHydrophilic
NLS Segment(s)
PositionSequence
118-130TTRRRRNIRRREK
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MAPSRRRLRLEHLPGRPYRIYSAGGIFPPTGPIGGWIDILHPDVYMSDLIEFVEHHSILIPPTPNGVVLTAADYRYAIEAHRWRIWNRGTQYTPSTQALSILPNDSGLTSVPNRRPMTTRRRRNIRRREKTPPQAGLNTPSHFGSRASSRRSSAESSHMPTPLPPPSRRPSRLPTVPTPPLPAVPPIVHAAPRTLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.7
3 0.64
4 0.55
5 0.48
6 0.41
7 0.36
8 0.3
9 0.31
10 0.27
11 0.26
12 0.25
13 0.22
14 0.19
15 0.18
16 0.16
17 0.13
18 0.09
19 0.11
20 0.12
21 0.12
22 0.12
23 0.11
24 0.11
25 0.12
26 0.14
27 0.11
28 0.09
29 0.08
30 0.07
31 0.09
32 0.08
33 0.07
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.07
40 0.09
41 0.09
42 0.08
43 0.09
44 0.09
45 0.1
46 0.13
47 0.12
48 0.09
49 0.11
50 0.11
51 0.11
52 0.11
53 0.11
54 0.08
55 0.07
56 0.09
57 0.09
58 0.09
59 0.09
60 0.08
61 0.08
62 0.08
63 0.08
64 0.06
65 0.11
66 0.15
67 0.2
68 0.24
69 0.26
70 0.26
71 0.33
72 0.35
73 0.36
74 0.36
75 0.39
76 0.36
77 0.36
78 0.38
79 0.33
80 0.34
81 0.28
82 0.25
83 0.18
84 0.17
85 0.15
86 0.14
87 0.12
88 0.1
89 0.09
90 0.08
91 0.08
92 0.07
93 0.06
94 0.05
95 0.07
96 0.08
97 0.13
98 0.16
99 0.24
100 0.25
101 0.26
102 0.3
103 0.36
104 0.46
105 0.51
106 0.59
107 0.6
108 0.71
109 0.8
110 0.87
111 0.9
112 0.9
113 0.9
114 0.88
115 0.88
116 0.88
117 0.88
118 0.86
119 0.81
120 0.74
121 0.67
122 0.61
123 0.57
124 0.51
125 0.42
126 0.35
127 0.29
128 0.25
129 0.22
130 0.21
131 0.18
132 0.21
133 0.27
134 0.31
135 0.33
136 0.35
137 0.37
138 0.4
139 0.41
140 0.35
141 0.36
142 0.36
143 0.37
144 0.38
145 0.35
146 0.32
147 0.29
148 0.31
149 0.32
150 0.33
151 0.32
152 0.36
153 0.45
154 0.55
155 0.58
156 0.61
157 0.6
158 0.64
159 0.7
160 0.69
161 0.68
162 0.67
163 0.68
164 0.63
165 0.62
166 0.53
167 0.47
168 0.41
169 0.36
170 0.32
171 0.26
172 0.26
173 0.24
174 0.24
175 0.25
176 0.24