Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165GJX3

Protein Details
Accession A0A165GJX3    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
184-203SSQPTPKSRSRRSHPLRDTTHydrophilic
NLS Segment(s)
PositionSequence
281-285RKRRR
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029196  HAPSTR1-like  
Pfam View protein in Pfam  
PF15251  DUF4588  
Amino Acid Sequences MDMSKLRDNLPAGGRTDAERDLTNDFKAAALSITKLYKSSLAASVSAWSAGYQAALSELLEKLDGPIAMDDIREWARTRIDAIGGGVSSGEMSDEERGRGRERERDERERRSVPPPVSSSKPSSRADDSSDRTSATNDRPRAHIYTDRVQDTTDEERPSFIHTSASLVATRTPFSSPTPVSVASSQPTPKSRSRRSHPLRDTTPVNSFPTAVTFAPALPAVSEFPFFPASMFESAQPTQYGIGMKRRHEVVDDTTAAAGRKARMRDRGSGDSMDFDGERDRKRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.3
3 0.31
4 0.27
5 0.24
6 0.21
7 0.21
8 0.24
9 0.25
10 0.24
11 0.21
12 0.2
13 0.18
14 0.17
15 0.15
16 0.11
17 0.1
18 0.1
19 0.13
20 0.15
21 0.15
22 0.16
23 0.16
24 0.17
25 0.18
26 0.2
27 0.21
28 0.2
29 0.2
30 0.2
31 0.2
32 0.18
33 0.17
34 0.14
35 0.09
36 0.08
37 0.07
38 0.07
39 0.05
40 0.05
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.07
50 0.09
51 0.09
52 0.08
53 0.08
54 0.09
55 0.09
56 0.09
57 0.08
58 0.09
59 0.1
60 0.11
61 0.12
62 0.14
63 0.15
64 0.15
65 0.17
66 0.15
67 0.15
68 0.14
69 0.13
70 0.12
71 0.1
72 0.1
73 0.08
74 0.06
75 0.05
76 0.04
77 0.04
78 0.03
79 0.04
80 0.07
81 0.08
82 0.09
83 0.12
84 0.13
85 0.16
86 0.21
87 0.23
88 0.28
89 0.34
90 0.44
91 0.49
92 0.58
93 0.63
94 0.66
95 0.7
96 0.66
97 0.63
98 0.58
99 0.57
100 0.48
101 0.46
102 0.42
103 0.4
104 0.39
105 0.39
106 0.39
107 0.37
108 0.42
109 0.38
110 0.39
111 0.37
112 0.35
113 0.37
114 0.38
115 0.37
116 0.34
117 0.32
118 0.29
119 0.26
120 0.26
121 0.24
122 0.25
123 0.28
124 0.28
125 0.29
126 0.3
127 0.33
128 0.33
129 0.33
130 0.31
131 0.28
132 0.31
133 0.34
134 0.33
135 0.31
136 0.29
137 0.26
138 0.25
139 0.25
140 0.21
141 0.19
142 0.18
143 0.18
144 0.18
145 0.21
146 0.19
147 0.14
148 0.12
149 0.11
150 0.13
151 0.13
152 0.14
153 0.11
154 0.1
155 0.12
156 0.11
157 0.12
158 0.11
159 0.11
160 0.11
161 0.12
162 0.17
163 0.16
164 0.17
165 0.19
166 0.19
167 0.2
168 0.2
169 0.2
170 0.16
171 0.18
172 0.18
173 0.19
174 0.22
175 0.26
176 0.31
177 0.4
178 0.48
179 0.55
180 0.61
181 0.69
182 0.74
183 0.8
184 0.8
185 0.8
186 0.74
187 0.7
188 0.65
189 0.58
190 0.55
191 0.47
192 0.42
193 0.33
194 0.29
195 0.24
196 0.23
197 0.21
198 0.16
199 0.14
200 0.12
201 0.11
202 0.12
203 0.12
204 0.1
205 0.07
206 0.08
207 0.08
208 0.09
209 0.1
210 0.09
211 0.11
212 0.12
213 0.12
214 0.11
215 0.11
216 0.13
217 0.15
218 0.15
219 0.14
220 0.18
221 0.18
222 0.2
223 0.19
224 0.17
225 0.14
226 0.16
227 0.18
228 0.17
229 0.25
230 0.29
231 0.31
232 0.35
233 0.37
234 0.36
235 0.35
236 0.36
237 0.33
238 0.36
239 0.34
240 0.31
241 0.29
242 0.29
243 0.27
244 0.24
245 0.21
246 0.17
247 0.22
248 0.28
249 0.34
250 0.42
251 0.47
252 0.54
253 0.59
254 0.62
255 0.6
256 0.57
257 0.51
258 0.44
259 0.4
260 0.34
261 0.26
262 0.2
263 0.23
264 0.25
265 0.31