FuNGI

G2X192

Protein Details

Accession

G2X192

Localization Confidence

Medium

Confidence Score

10.1

NoLS Segment(s)

Position	Sequence	Protein Nature
3-35	GATYNVLRRSQRRSRRNTPKFVGRPRHNLARRQ	Hydrophilic

NLS Segment(s)

Position	Sequence
12-32	SQRRSRRNTPKFVGRPRHNLA

Subcellular Location(s)

mito 10, nucl 6.5, cyto_nucl 5, pero 3, cyto 2.5, plas 2, extr 2

Family & Domain DBs

Gene Ontology	GO:0016020 C:membrane
KEGG	vda:VDAG_04021 -

Amino Acid Sequences

MDGATYNVLRRSQRRSRRNTPKFVGRPRHNLARRQAPPPQPVPTVPGSESNSDIAVPGVPGAADSDSDSGNEAAQPLPPGPVPPPGAVPPGVAPPPVAQVDSSDDGADSGNEQLQPAPLPPPGFPTNGAAPQLGPQPVGQIPGALPFTTTLPGNPVQTGNVPPPQQPAPVNPDAGRRPPSNAERPLPGSMNTIPPVGAIPTTVPQAPAPVQPPVPVQPPPQAQPPAPVQPVQPVQPVQPVQPPPQVQQPQQPQQPQQPPQQPQPVLPLPAASASLPNPSQPSAALPSAVQPPLAGIPGLTSIAREEVAPMPTGSADAAPVIAPANTGGDSDRGIAVGITFGTLALIGILVAIGIFIFKKNSSKKADVEAAAPPPAPVAAPAPLAIPQTARAPRANNQTIIEAYGRDENDMEQMGYYNEKGFQKLPPLPQQRGDQGYDGEDDYNNNNRNDNSSYMPGQGGLPVAQRDSDGRYLGR

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.68
2	0.75
3	0.81
4	0.86
5	0.9
6	0.91
7	0.89
8	0.9
9	0.9
10	0.9
11	0.9
12	0.87
13	0.86
14	0.84
15	0.86
16	0.82
17	0.8
18	0.78
19	0.78
20	0.75
21	0.72
22	0.74
23	0.71
24	0.72
25	0.69
26	0.66
27	0.59
28	0.55
29	0.53
30	0.47
31	0.43
32	0.36
33	0.37
34	0.35
35	0.33
36	0.33
37	0.29
38	0.26
39	0.22
40	0.2
41	0.14
42	0.11
43	0.09
44	0.07
45	0.06
46	0.05
47	0.05
48	0.07
49	0.06
50	0.06
51	0.08
52	0.09
53	0.09
54	0.09
55	0.11
56	0.1
57	0.1
58	0.1
59	0.09
60	0.09
61	0.1
62	0.11
63	0.1
64	0.12
65	0.12
66	0.13
67	0.14
68	0.19
69	0.21
70	0.2
71	0.23
72	0.23
73	0.26
74	0.24
75	0.23
76	0.19
77	0.2
78	0.2
79	0.17
80	0.16
81	0.14
82	0.17
83	0.17
84	0.16
85	0.12
86	0.13
87	0.18
88	0.19
89	0.18
90	0.14
91	0.14
92	0.13
93	0.14
94	0.12
95	0.08
96	0.07
97	0.08
98	0.08
99	0.09
100	0.09
101	0.1
102	0.1
103	0.11
104	0.12
105	0.13
106	0.14
107	0.14
108	0.19
109	0.21
110	0.22
111	0.22
112	0.23
113	0.24
114	0.26
115	0.27
116	0.21
117	0.18
118	0.19
119	0.22
120	0.19
121	0.16
122	0.13
123	0.15
124	0.15
125	0.17
126	0.14
127	0.11
128	0.11
129	0.13
130	0.14
131	0.11
132	0.11
133	0.09
134	0.11
135	0.11
136	0.11
137	0.08
138	0.11
139	0.12
140	0.13
141	0.14
142	0.13
143	0.13
144	0.15
145	0.17
146	0.17
147	0.2
148	0.2
149	0.2
150	0.23
151	0.24
152	0.25
153	0.24
154	0.24
155	0.27
156	0.28
157	0.29
158	0.27
159	0.31
160	0.31
161	0.34
162	0.35
163	0.28
164	0.29
165	0.34
166	0.4
167	0.42
168	0.45
169	0.43
170	0.41
171	0.44
172	0.43
173	0.37
174	0.31
175	0.26
176	0.22
177	0.23
178	0.2
179	0.18
180	0.15
181	0.14
182	0.13
183	0.1
184	0.08
185	0.05
186	0.05
187	0.06
188	0.08
189	0.08
190	0.08
191	0.08
192	0.09
193	0.1
194	0.12
195	0.13
196	0.14
197	0.14
198	0.14
199	0.16
200	0.16
201	0.18
202	0.17
203	0.18
204	0.22
205	0.24
206	0.25
207	0.29
208	0.29
209	0.26
210	0.28
211	0.29
212	0.28
213	0.27
214	0.26
215	0.21
216	0.23
217	0.25
218	0.22
219	0.21
220	0.17
221	0.16
222	0.2
223	0.2
224	0.17
225	0.2
226	0.22
227	0.23
228	0.27
229	0.27
230	0.25
231	0.33
232	0.35
233	0.32
234	0.37
235	0.42
236	0.44
237	0.48
238	0.5
239	0.45
240	0.5
241	0.56
242	0.53
243	0.54
244	0.55
245	0.54
246	0.56
247	0.6
248	0.52
249	0.46
250	0.47
251	0.41
252	0.34
253	0.3
254	0.24
255	0.16
256	0.16
257	0.15
258	0.09
259	0.08
260	0.07
261	0.1
262	0.1
263	0.1
264	0.11
265	0.11
266	0.11
267	0.1
268	0.12
269	0.13
270	0.13
271	0.12
272	0.11
273	0.13
274	0.16
275	0.16
276	0.14
277	0.1
278	0.1
279	0.1
280	0.11
281	0.08
282	0.04
283	0.05
284	0.06
285	0.07
286	0.06
287	0.05
288	0.05
289	0.06
290	0.07
291	0.06
292	0.08
293	0.09
294	0.11
295	0.11
296	0.11
297	0.1
298	0.1
299	0.1
300	0.08
301	0.06
302	0.05
303	0.04
304	0.05
305	0.04
306	0.05
307	0.05
308	0.04
309	0.04
310	0.04
311	0.05
312	0.05
313	0.06
314	0.06
315	0.07
316	0.07
317	0.08
318	0.08
319	0.07
320	0.07
321	0.06
322	0.06
323	0.05
324	0.05
325	0.04
326	0.04
327	0.04
328	0.04
329	0.03
330	0.03
331	0.03
332	0.03
333	0.02
334	0.02
335	0.02
336	0.02
337	0.02
338	0.02
339	0.02
340	0.02
341	0.03
342	0.03
343	0.05
344	0.06
345	0.14
346	0.2
347	0.28
348	0.35
349	0.4
350	0.42
351	0.48
352	0.53
353	0.46
354	0.44
355	0.4
356	0.35
357	0.32
358	0.29
359	0.22
360	0.16
361	0.15
362	0.12
363	0.09
364	0.09
365	0.09
366	0.09
367	0.1
368	0.1
369	0.12
370	0.13
371	0.13
372	0.11
373	0.11
374	0.18
375	0.21
376	0.24
377	0.25
378	0.28
379	0.35
380	0.45
381	0.48
382	0.43
383	0.42
384	0.42
385	0.39
386	0.37
387	0.31
388	0.21
389	0.18
390	0.2
391	0.19
392	0.17
393	0.17
394	0.15
395	0.17
396	0.17
397	0.15
398	0.11
399	0.11
400	0.11
401	0.13
402	0.13
403	0.12
404	0.16
405	0.17
406	0.2
407	0.21
408	0.23
409	0.3
410	0.36
411	0.42
412	0.47
413	0.54
414	0.56
415	0.61
416	0.63
417	0.61
418	0.6
419	0.55
420	0.47
421	0.41
422	0.38
423	0.34
424	0.29
425	0.23
426	0.19
427	0.18
428	0.2
429	0.27
430	0.3
431	0.29
432	0.31
433	0.31
434	0.35
435	0.37
436	0.36
437	0.33
438	0.33
439	0.34
440	0.33
441	0.32
442	0.28
443	0.25
444	0.22
445	0.19
446	0.15
447	0.17
448	0.16
449	0.17
450	0.16
451	0.17
452	0.18
453	0.22
454	0.24

G2X192

3D AlphaFold-predicted Structure Viewer