Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165G0Q2

Protein Details
Accession A0A165G0Q2    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
89-114RPPHALPKRTSLKRPRVDRPRHTVALBasic
NLS Segment(s)
PositionSequence
74-108RVARSELKQGGSGPGRPPHALPKRTSLKRPRVDRP
Subcellular Location(s) nucl 7, plas 6, mito_nucl 6, mito 5, extr 3
Family & Domain DBs
Amino Acid Sequences MHAPTASDVHPIHTAQTGGEAMHGGAQSAPSCIIIVQALGDCMALYGIVLYCVAPKSSLGPRNVSGGLMPPARRVARSELKQGGSGPGRPPHALPKRTSLKRPRVDRPRHTVALSDLSHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.14
3 0.17
4 0.14
5 0.11
6 0.11
7 0.1
8 0.08
9 0.1
10 0.1
11 0.07
12 0.07
13 0.08
14 0.08
15 0.08
16 0.09
17 0.07
18 0.07
19 0.06
20 0.07
21 0.06
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.04
29 0.04
30 0.04
31 0.03
32 0.02
33 0.03
34 0.02
35 0.03
36 0.03
37 0.03
38 0.04
39 0.04
40 0.05
41 0.05
42 0.05
43 0.08
44 0.14
45 0.19
46 0.2
47 0.22
48 0.23
49 0.26
50 0.26
51 0.22
52 0.17
53 0.13
54 0.15
55 0.15
56 0.14
57 0.12
58 0.17
59 0.17
60 0.18
61 0.18
62 0.23
63 0.3
64 0.33
65 0.39
66 0.4
67 0.41
68 0.41
69 0.39
70 0.38
71 0.31
72 0.31
73 0.28
74 0.27
75 0.29
76 0.28
77 0.29
78 0.34
79 0.41
80 0.43
81 0.41
82 0.47
83 0.54
84 0.6
85 0.68
86 0.68
87 0.7
88 0.74
89 0.8
90 0.81
91 0.82
92 0.86
93 0.86
94 0.85
95 0.83
96 0.78
97 0.7
98 0.63
99 0.56
100 0.54