Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165CDU8

Protein Details
Accession A0A165CDU8    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
25-49HVSHSKKACNHCRSMKKRCRTVNGFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MLHVQHNGGPGGGGEGPGDNPGGRHVSHSKKACNHCRSMKKRCRTVNGFDRCARCIKAGQACDFSGTDGRQRTTNSYGQPNGPAQASNNPAGATQPPAPAQDHQDDNAGSTSENDGSLGGQDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.09
5 0.1
6 0.07
7 0.07
8 0.09
9 0.11
10 0.11
11 0.16
12 0.22
13 0.29
14 0.38
15 0.43
16 0.48
17 0.54
18 0.63
19 0.69
20 0.68
21 0.68
22 0.69
23 0.75
24 0.77
25 0.8
26 0.8
27 0.79
28 0.82
29 0.81
30 0.81
31 0.76
32 0.76
33 0.75
34 0.73
35 0.69
36 0.64
37 0.59
38 0.51
39 0.48
40 0.4
41 0.31
42 0.25
43 0.24
44 0.26
45 0.26
46 0.26
47 0.26
48 0.25
49 0.25
50 0.23
51 0.19
52 0.15
53 0.13
54 0.15
55 0.14
56 0.15
57 0.16
58 0.17
59 0.2
60 0.23
61 0.27
62 0.27
63 0.3
64 0.31
65 0.3
66 0.32
67 0.29
68 0.26
69 0.22
70 0.19
71 0.15
72 0.19
73 0.21
74 0.19
75 0.19
76 0.18
77 0.17
78 0.18
79 0.17
80 0.16
81 0.15
82 0.16
83 0.17
84 0.19
85 0.21
86 0.22
87 0.25
88 0.27
89 0.27
90 0.26
91 0.28
92 0.26
93 0.26
94 0.25
95 0.21
96 0.15
97 0.14
98 0.15
99 0.13
100 0.13
101 0.11
102 0.1
103 0.1