Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165DE19

Protein Details
Accession A0A165DE19    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
26-52RPQTQCTVCRERRKKDRSHVRCNCAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR001083  Cu_fist_DNA-bd_dom  
IPR036395  Cu_fist_DNA-bd_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005507  F:copper ion binding  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00649  Copper-fist  
PROSITE View protein in PROSITE  
PS50073  COPPER_FIST_2  
Amino Acid Sequences TCIKGHRSSACLHGTRALFEIKRKGRPQTQCTVCRERRKKDRSHVRCNCAGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.31
4 0.28
5 0.22
6 0.24
7 0.32
8 0.31
9 0.39
10 0.41
11 0.45
12 0.48
13 0.55
14 0.58
15 0.58
16 0.62
17 0.6
18 0.64
19 0.68
20 0.68
21 0.71
22 0.74
23 0.74
24 0.77
25 0.79
26 0.82
27 0.83
28 0.87
29 0.86
30 0.89
31 0.89
32 0.85