Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165F784

Protein Details
Accession A0A165F784   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MSPPHPPRPPQLRKRRRRRPRKRERERQTRTYAHTSBasic
NLS Segment(s)
PositionSequence
6-27PPRPPQLRKRRRRRPRKRERER
Subcellular Location(s) mito 13, nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR045871  AHP1-5/YPD1  
IPR036641  HPT_dom_sf  
IPR008207  Sig_transdc_His_kin_Hpt_dom  
Gene Ontology GO:0009927  F:histidine phosphotransfer kinase activity  
GO:0043424  F:protein histidine kinase binding  
GO:0000160  P:phosphorelay signal transduction system  
Pfam View protein in Pfam  
PF01627  Hpt  
PROSITE View protein in PROSITE  
PS50894  HPT  
CDD cd00088  HPT  
Amino Acid Sequences MSPPHPPRPPQLRKRRRRRPRKRERERQTRTYAHTSCSLSHPDGRHQAPAPVIDMDTFSQILEMDDDDTHEFSLSIVENYMEQAAATFDSMSAAVDAENLPELSRLGHFLKGSSAALGISQVQTGCEAMQYYGQLKRGANGTKMAPKEALDLITTLLAKIKEGHTEADKWLRDFYGVESWGSPEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.95
3 0.95
4 0.95
5 0.96
6 0.96
7 0.97
8 0.97
9 0.97
10 0.97
11 0.97
12 0.97
13 0.94
14 0.92
15 0.9
16 0.86
17 0.81
18 0.8
19 0.7
20 0.62
21 0.58
22 0.51
23 0.44
24 0.4
25 0.37
26 0.3
27 0.33
28 0.32
29 0.32
30 0.38
31 0.37
32 0.38
33 0.35
34 0.35
35 0.31
36 0.3
37 0.26
38 0.19
39 0.18
40 0.13
41 0.14
42 0.11
43 0.11
44 0.1
45 0.08
46 0.07
47 0.07
48 0.07
49 0.06
50 0.06
51 0.06
52 0.06
53 0.07
54 0.08
55 0.08
56 0.08
57 0.07
58 0.07
59 0.06
60 0.07
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.03
76 0.04
77 0.04
78 0.04
79 0.03
80 0.03
81 0.03
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.05
91 0.05
92 0.08
93 0.09
94 0.11
95 0.11
96 0.11
97 0.12
98 0.13
99 0.13
100 0.1
101 0.09
102 0.06
103 0.06
104 0.07
105 0.06
106 0.05
107 0.06
108 0.05
109 0.05
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.06
116 0.07
117 0.08
118 0.1
119 0.13
120 0.16
121 0.18
122 0.18
123 0.19
124 0.24
125 0.26
126 0.25
127 0.26
128 0.27
129 0.3
130 0.32
131 0.32
132 0.27
133 0.24
134 0.26
135 0.24
136 0.21
137 0.15
138 0.14
139 0.13
140 0.14
141 0.13
142 0.1
143 0.12
144 0.11
145 0.11
146 0.13
147 0.14
148 0.17
149 0.19
150 0.23
151 0.23
152 0.26
153 0.3
154 0.35
155 0.36
156 0.33
157 0.33
158 0.3
159 0.27
160 0.26
161 0.25
162 0.25
163 0.24
164 0.23
165 0.22
166 0.23