Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165J0M0

Protein Details
Accession A0A165J0M0    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-32SGFTNRKTPKATPRRPAPAGPHydrophilic
75-102YYLDRRRGSGTKQRRRRKAAAKTKEASTHydrophilic
NLS Segment(s)
PositionSequence
79-99RRRGSGTKQRRRRKAAAKTKE
111-118KASKKRKR
382-435MGRAKRERVEGRRGAKAARVEKAGKEGGEGKADKEGKMGAAGKAANPGNTAKRQ
Subcellular Location(s) nucl 13, cyto 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013241  RNase_P_Pop3  
Gene Ontology GO:0006364  P:rRNA processing  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF08228  RNase_P_pop3  
Amino Acid Sequences MSAENKTARVYSGFTNRKTPKATPRRPAPAGPDRRVVFKSVLHNPLQIEWPVIPLAIQPKVLAAACEVLKDLAPYYLDRRRGSGTKQRRRRKAAAKTKEASTTSADGAVDKASKKRKRGEAVEPDPEDDSASPSKKPRTTEILESTAVPADAAPAAPADASDADVDMPMTATARQPTPAPPLLDHLTIGINEVTRQLEVATLALQERLFPPPAPASSATAPADLLLTQPEAEADAPSAPAAIPASHADPNAGPTPNANPPKPPRVILVCRPDISPPLLVAHLPLLVAAYNSLLPLSELDGAGVHLVTLPKGGELALAASVGLRRVAVLAFDADAPSLPQILKPLHPANLRPLTAPWLSANPGNAAYIPTHVKQLRTSAPRDMGRAKRERVEGRRGAKAARVEKAGKEGGEGKADKEGKMGAAGKAANPGNTAKRQQGKGTGSGKQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.51
3 0.54
4 0.59
5 0.62
6 0.63
7 0.63
8 0.67
9 0.74
10 0.74
11 0.79
12 0.82
13 0.81
14 0.79
15 0.77
16 0.77
17 0.77
18 0.71
19 0.69
20 0.61
21 0.62
22 0.58
23 0.52
24 0.45
25 0.4
26 0.44
27 0.44
28 0.48
29 0.45
30 0.46
31 0.43
32 0.42
33 0.4
34 0.32
35 0.26
36 0.2
37 0.2
38 0.17
39 0.16
40 0.13
41 0.12
42 0.17
43 0.16
44 0.17
45 0.15
46 0.15
47 0.18
48 0.18
49 0.15
50 0.11
51 0.14
52 0.13
53 0.14
54 0.14
55 0.12
56 0.12
57 0.12
58 0.12
59 0.09
60 0.1
61 0.12
62 0.18
63 0.24
64 0.31
65 0.31
66 0.33
67 0.37
68 0.41
69 0.47
70 0.51
71 0.56
72 0.6
73 0.7
74 0.77
75 0.82
76 0.86
77 0.89
78 0.88
79 0.88
80 0.89
81 0.89
82 0.88
83 0.82
84 0.76
85 0.73
86 0.64
87 0.55
88 0.47
89 0.39
90 0.3
91 0.28
92 0.24
93 0.17
94 0.16
95 0.16
96 0.14
97 0.14
98 0.2
99 0.28
100 0.34
101 0.41
102 0.49
103 0.57
104 0.63
105 0.68
106 0.73
107 0.74
108 0.75
109 0.76
110 0.68
111 0.61
112 0.52
113 0.45
114 0.35
115 0.24
116 0.21
117 0.17
118 0.17
119 0.19
120 0.23
121 0.3
122 0.33
123 0.35
124 0.37
125 0.41
126 0.43
127 0.49
128 0.49
129 0.46
130 0.43
131 0.41
132 0.36
133 0.28
134 0.24
135 0.16
136 0.1
137 0.06
138 0.06
139 0.05
140 0.05
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.05
148 0.05
149 0.05
150 0.05
151 0.05
152 0.06
153 0.04
154 0.04
155 0.04
156 0.04
157 0.05
158 0.06
159 0.08
160 0.08
161 0.09
162 0.1
163 0.13
164 0.18
165 0.21
166 0.21
167 0.2
168 0.24
169 0.25
170 0.25
171 0.22
172 0.17
173 0.14
174 0.12
175 0.13
176 0.09
177 0.07
178 0.07
179 0.08
180 0.07
181 0.06
182 0.07
183 0.06
184 0.06
185 0.06
186 0.06
187 0.05
188 0.05
189 0.05
190 0.06
191 0.06
192 0.06
193 0.07
194 0.09
195 0.1
196 0.09
197 0.11
198 0.12
199 0.12
200 0.14
201 0.14
202 0.15
203 0.15
204 0.18
205 0.16
206 0.15
207 0.14
208 0.12
209 0.11
210 0.08
211 0.07
212 0.05
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.04
224 0.05
225 0.04
226 0.04
227 0.04
228 0.04
229 0.05
230 0.06
231 0.08
232 0.09
233 0.1
234 0.1
235 0.1
236 0.12
237 0.14
238 0.14
239 0.11
240 0.11
241 0.15
242 0.22
243 0.26
244 0.24
245 0.27
246 0.32
247 0.4
248 0.41
249 0.39
250 0.35
251 0.38
252 0.43
253 0.44
254 0.47
255 0.43
256 0.42
257 0.42
258 0.39
259 0.33
260 0.3
261 0.22
262 0.15
263 0.13
264 0.12
265 0.11
266 0.11
267 0.09
268 0.08
269 0.07
270 0.06
271 0.05
272 0.05
273 0.05
274 0.04
275 0.04
276 0.04
277 0.04
278 0.04
279 0.04
280 0.04
281 0.04
282 0.06
283 0.06
284 0.06
285 0.06
286 0.07
287 0.07
288 0.07
289 0.06
290 0.04
291 0.05
292 0.05
293 0.05
294 0.06
295 0.06
296 0.05
297 0.06
298 0.06
299 0.04
300 0.04
301 0.05
302 0.04
303 0.04
304 0.04
305 0.04
306 0.05
307 0.05
308 0.05
309 0.04
310 0.04
311 0.05
312 0.05
313 0.05
314 0.06
315 0.06
316 0.06
317 0.07
318 0.07
319 0.06
320 0.06
321 0.07
322 0.06
323 0.07
324 0.06
325 0.07
326 0.1
327 0.13
328 0.14
329 0.2
330 0.23
331 0.28
332 0.31
333 0.33
334 0.38
335 0.43
336 0.42
337 0.37
338 0.35
339 0.34
340 0.31
341 0.31
342 0.23
343 0.19
344 0.2
345 0.2
346 0.2
347 0.17
348 0.17
349 0.16
350 0.15
351 0.13
352 0.12
353 0.14
354 0.17
355 0.15
356 0.23
357 0.24
358 0.26
359 0.27
360 0.33
361 0.39
362 0.41
363 0.44
364 0.43
365 0.49
366 0.5
367 0.53
368 0.55
369 0.54
370 0.57
371 0.62
372 0.59
373 0.58
374 0.64
375 0.69
376 0.67
377 0.7
378 0.69
379 0.66
380 0.7
381 0.65
382 0.59
383 0.54
384 0.55
385 0.51
386 0.48
387 0.48
388 0.44
389 0.44
390 0.48
391 0.46
392 0.37
393 0.34
394 0.34
395 0.3
396 0.35
397 0.33
398 0.28
399 0.34
400 0.36
401 0.32
402 0.29
403 0.28
404 0.21
405 0.26
406 0.28
407 0.2
408 0.23
409 0.24
410 0.23
411 0.29
412 0.29
413 0.25
414 0.24
415 0.28
416 0.31
417 0.37
418 0.4
419 0.42
420 0.49
421 0.53
422 0.56
423 0.61
424 0.59
425 0.61
426 0.62