Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165CZH0

Protein Details
Accession A0A165CZH0   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPPKRGSERKQPQRTTQLSLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 6, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039723  Vps71/ZNHIT1  
IPR007529  Znf_HIT  
Gene Ontology GO:0005634  C:nucleus  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF04438  zf-HIT  
Amino Acid Sequences MPPKRGSERKQPQRTTQLSLDYLARRTRRYLDELERVNYHKFGDSADDKERLAVTEGRRAGPAGKAKTAAGGRKSTMGVRQLLLYRKGLATLIDESGLKDLPASTPTYLSAAAPPPSEPRLRFCVSCGYWGAYRCQKCGDEFCSIRCGEWHRELRCGKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.77
3 0.7
4 0.65
5 0.56
6 0.51
7 0.47
8 0.39
9 0.38
10 0.38
11 0.37
12 0.33
13 0.35
14 0.39
15 0.39
16 0.41
17 0.45
18 0.46
19 0.51
20 0.53
21 0.53
22 0.49
23 0.47
24 0.44
25 0.37
26 0.3
27 0.23
28 0.19
29 0.17
30 0.2
31 0.2
32 0.23
33 0.25
34 0.26
35 0.24
36 0.25
37 0.24
38 0.18
39 0.18
40 0.18
41 0.16
42 0.22
43 0.23
44 0.23
45 0.23
46 0.23
47 0.21
48 0.22
49 0.26
50 0.22
51 0.22
52 0.22
53 0.22
54 0.25
55 0.27
56 0.26
57 0.22
58 0.21
59 0.21
60 0.21
61 0.22
62 0.19
63 0.19
64 0.18
65 0.17
66 0.15
67 0.16
68 0.18
69 0.2
70 0.21
71 0.18
72 0.16
73 0.15
74 0.15
75 0.14
76 0.11
77 0.1
78 0.1
79 0.09
80 0.09
81 0.09
82 0.09
83 0.09
84 0.09
85 0.07
86 0.06
87 0.05
88 0.06
89 0.07
90 0.09
91 0.08
92 0.09
93 0.1
94 0.11
95 0.11
96 0.11
97 0.11
98 0.13
99 0.14
100 0.13
101 0.14
102 0.16
103 0.19
104 0.23
105 0.22
106 0.24
107 0.3
108 0.32
109 0.31
110 0.3
111 0.36
112 0.33
113 0.35
114 0.32
115 0.29
116 0.29
117 0.3
118 0.34
119 0.34
120 0.35
121 0.33
122 0.36
123 0.35
124 0.36
125 0.41
126 0.39
127 0.4
128 0.39
129 0.4
130 0.41
131 0.39
132 0.35
133 0.32
134 0.34
135 0.32
136 0.4
137 0.47
138 0.43
139 0.52