Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165ITD6

Protein Details
Accession A0A165ITD6    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MRRESRAKKRKKRKKRKERRIVHRSSTIVBasic
NLS Segment(s)
PositionSequence
3-21RESRAKKRKKRKKRKERRI
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MRRESRAKKRKKRKKRKERRIVHRSSTIVYYPFRNQLISGQLPRRQPLLAVGMMTAPLSMPIGTGETPDLYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.97
2 0.97
3 0.97
4 0.97
5 0.97
6 0.96
7 0.96
8 0.93
9 0.88
10 0.83
11 0.74
12 0.64
13 0.56
14 0.46
15 0.37
16 0.3
17 0.26
18 0.21
19 0.23
20 0.21
21 0.19
22 0.17
23 0.17
24 0.2
25 0.2
26 0.22
27 0.23
28 0.27
29 0.28
30 0.29
31 0.29
32 0.24
33 0.22
34 0.21
35 0.2
36 0.16
37 0.15
38 0.14
39 0.12
40 0.13
41 0.12
42 0.09
43 0.05
44 0.04
45 0.05
46 0.05
47 0.05
48 0.05
49 0.08
50 0.08
51 0.09
52 0.1