Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165DLJ2

Protein Details
Accession A0A165DLJ2    Localization Confidence High Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
149-173LVDTARKKRQASRRREQLRDPPPVLHydrophilic
210-239HQPQPQPQPQPQPQPKPKQKKAQTQSPGHPHydrophilic
637-660AGGTKRRRSPVKPRGQTRPRPVLLHydrophilic
807-836SQTTTLRRTGPRSTRRKRSGVRGGRMRASCHydrophilic
NLS Segment(s)
PositionSequence
155-163KKRQASRRR
259-315APSRPGPGPGPGSGASRRKLDPPRPFVRPASPARARTRADGPNGAASPAKGKRRGKG
591-594RKRP
602-655DRPGPFKRSRPSTLPSQSRKENARPSAGAGAGAGAAGGTKRRRSPVKPRGQTRP
814-834RTGPRSTRRKRSGVRGGRMRA
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MPTHAPPRASPSFHLPAQYLPLHSPSPPPNRTSNPTTHPPHPHPHPHPHAYPPPDPDPDASLPLALPNAWGDATMLRDVRMPWDDGDSALLAPACPPPRSRSGPGGVGELMQHTGERAREDSEPAPGKPRTALAQQVGKDMHVDLDLPLVDTARKKRQASRRREQLRDPPPVLALPRTAADRQEAPAPAEPAPNPPSAPAPPASARNTPHQPQPQPQPQPQPQPKPKQKKAQTQSPGHPMLADHRPEHRPSHRDTAPVAPSRPGPGPGPGSGASRRKLDPPRPFVRPASPARARTRADGPNGAASPAKGKRRGKGGLELDVGSVPVHGYEGACAAAPPPTPSARAPAPGPPATRSPANLPADETAPLPPPTPAAIRQTQQPQAQARSAQGESGDEASFGGLMRKLRSYRVRFGPAGVDAARAGEGEGDGQGASPLASSCSSSESSDDTPPPPAPQPAIAAVQAQAAPLPPVLPTPPASAAPAPPAAAAAAAAGEAAQARTRAATSLLSRRDAVPAPSSAAPPPPAVPWDVLPERGMSLLAKLEAAARQTVRSALPPSPARPVRPTPQPPARTADPLPPSEPASAPPPHNARKRPTAPEEDADRPGPFKRSRPSTLPSQSRKENARPSAGAGAGAGAAGGTKRRRSPVKPRGQTRPRPVLLASVFQVGLGAEPQPEKPAEELGDRPAPGLAGALVLEGRPKEGHRARSVLAATTALDGRAKERLGTRRGEEERGKKLLLEGASERIRALEEKKQVLVESIQAKHSTESRQHRSSPSSPPPCTRTSRRLQAHAQPGSHARPTPTRLPGSQTTTLRRTGPRSTRRKRSGVRGGRMRASCASRRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.4
3 0.35
4 0.38
5 0.37
6 0.31
7 0.27
8 0.29
9 0.28
10 0.28
11 0.32
12 0.36
13 0.43
14 0.45
15 0.47
16 0.51
17 0.57
18 0.63
19 0.63
20 0.62
21 0.59
22 0.64
23 0.67
24 0.67
25 0.69
26 0.68
27 0.71
28 0.72
29 0.75
30 0.74
31 0.78
32 0.79
33 0.77
34 0.75
35 0.75
36 0.75
37 0.71
38 0.69
39 0.65
40 0.62
41 0.58
42 0.55
43 0.48
44 0.45
45 0.41
46 0.38
47 0.31
48 0.26
49 0.22
50 0.21
51 0.2
52 0.13
53 0.11
54 0.09
55 0.1
56 0.09
57 0.09
58 0.09
59 0.1
60 0.12
61 0.15
62 0.15
63 0.14
64 0.16
65 0.17
66 0.21
67 0.22
68 0.22
69 0.19
70 0.23
71 0.23
72 0.21
73 0.22
74 0.17
75 0.15
76 0.14
77 0.13
78 0.09
79 0.09
80 0.15
81 0.17
82 0.18
83 0.2
84 0.24
85 0.32
86 0.4
87 0.44
88 0.46
89 0.48
90 0.52
91 0.51
92 0.49
93 0.41
94 0.34
95 0.29
96 0.23
97 0.18
98 0.13
99 0.11
100 0.09
101 0.11
102 0.12
103 0.14
104 0.15
105 0.17
106 0.18
107 0.23
108 0.23
109 0.29
110 0.31
111 0.3
112 0.36
113 0.34
114 0.34
115 0.31
116 0.32
117 0.28
118 0.28
119 0.34
120 0.32
121 0.38
122 0.37
123 0.41
124 0.39
125 0.35
126 0.31
127 0.25
128 0.2
129 0.14
130 0.14
131 0.08
132 0.1
133 0.1
134 0.1
135 0.1
136 0.09
137 0.11
138 0.15
139 0.22
140 0.29
141 0.37
142 0.4
143 0.49
144 0.6
145 0.68
146 0.73
147 0.77
148 0.79
149 0.81
150 0.84
151 0.83
152 0.83
153 0.82
154 0.81
155 0.72
156 0.62
157 0.54
158 0.5
159 0.43
160 0.35
161 0.26
162 0.18
163 0.18
164 0.2
165 0.19
166 0.18
167 0.2
168 0.2
169 0.2
170 0.24
171 0.24
172 0.23
173 0.25
174 0.26
175 0.24
176 0.25
177 0.24
178 0.25
179 0.27
180 0.26
181 0.22
182 0.21
183 0.24
184 0.22
185 0.24
186 0.2
187 0.21
188 0.22
189 0.27
190 0.31
191 0.32
192 0.33
193 0.38
194 0.44
195 0.42
196 0.49
197 0.52
198 0.52
199 0.54
200 0.62
201 0.64
202 0.65
203 0.68
204 0.69
205 0.68
206 0.74
207 0.76
208 0.77
209 0.77
210 0.81
211 0.85
212 0.86
213 0.88
214 0.88
215 0.88
216 0.88
217 0.86
218 0.86
219 0.85
220 0.81
221 0.79
222 0.77
223 0.69
224 0.58
225 0.5
226 0.4
227 0.36
228 0.35
229 0.31
230 0.25
231 0.28
232 0.32
233 0.34
234 0.41
235 0.43
236 0.41
237 0.44
238 0.51
239 0.48
240 0.46
241 0.46
242 0.47
243 0.46
244 0.46
245 0.41
246 0.34
247 0.32
248 0.33
249 0.32
250 0.26
251 0.2
252 0.2
253 0.22
254 0.2
255 0.23
256 0.21
257 0.23
258 0.27
259 0.3
260 0.29
261 0.29
262 0.3
263 0.35
264 0.42
265 0.48
266 0.52
267 0.56
268 0.6
269 0.61
270 0.64
271 0.59
272 0.56
273 0.54
274 0.49
275 0.5
276 0.5
277 0.52
278 0.54
279 0.58
280 0.53
281 0.5
282 0.52
283 0.48
284 0.45
285 0.41
286 0.37
287 0.34
288 0.33
289 0.3
290 0.23
291 0.18
292 0.21
293 0.23
294 0.28
295 0.31
296 0.34
297 0.38
298 0.45
299 0.5
300 0.47
301 0.51
302 0.49
303 0.45
304 0.44
305 0.4
306 0.33
307 0.27
308 0.24
309 0.15
310 0.11
311 0.06
312 0.04
313 0.04
314 0.04
315 0.04
316 0.04
317 0.04
318 0.04
319 0.04
320 0.04
321 0.04
322 0.06
323 0.07
324 0.08
325 0.09
326 0.1
327 0.12
328 0.13
329 0.17
330 0.16
331 0.18
332 0.18
333 0.2
334 0.25
335 0.26
336 0.27
337 0.25
338 0.26
339 0.26
340 0.26
341 0.23
342 0.21
343 0.26
344 0.27
345 0.25
346 0.24
347 0.23
348 0.23
349 0.22
350 0.19
351 0.12
352 0.13
353 0.13
354 0.12
355 0.11
356 0.1
357 0.11
358 0.12
359 0.14
360 0.16
361 0.18
362 0.19
363 0.23
364 0.28
365 0.32
366 0.32
367 0.35
368 0.33
369 0.33
370 0.34
371 0.3
372 0.26
373 0.24
374 0.22
375 0.18
376 0.14
377 0.12
378 0.11
379 0.12
380 0.11
381 0.07
382 0.07
383 0.06
384 0.06
385 0.06
386 0.06
387 0.06
388 0.07
389 0.08
390 0.11
391 0.12
392 0.18
393 0.26
394 0.31
395 0.36
396 0.41
397 0.45
398 0.43
399 0.43
400 0.39
401 0.31
402 0.28
403 0.21
404 0.15
405 0.1
406 0.1
407 0.09
408 0.07
409 0.06
410 0.04
411 0.04
412 0.03
413 0.03
414 0.03
415 0.03
416 0.03
417 0.03
418 0.03
419 0.03
420 0.03
421 0.03
422 0.04
423 0.04
424 0.05
425 0.05
426 0.08
427 0.09
428 0.09
429 0.1
430 0.12
431 0.14
432 0.15
433 0.16
434 0.14
435 0.16
436 0.16
437 0.17
438 0.16
439 0.14
440 0.13
441 0.13
442 0.14
443 0.13
444 0.14
445 0.13
446 0.12
447 0.11
448 0.11
449 0.1
450 0.08
451 0.07
452 0.05
453 0.06
454 0.05
455 0.05
456 0.04
457 0.05
458 0.05
459 0.07
460 0.08
461 0.1
462 0.11
463 0.12
464 0.13
465 0.13
466 0.13
467 0.14
468 0.13
469 0.11
470 0.09
471 0.09
472 0.07
473 0.06
474 0.06
475 0.04
476 0.03
477 0.03
478 0.02
479 0.02
480 0.02
481 0.03
482 0.03
483 0.04
484 0.04
485 0.04
486 0.05
487 0.05
488 0.06
489 0.07
490 0.09
491 0.12
492 0.19
493 0.21
494 0.22
495 0.23
496 0.23
497 0.25
498 0.24
499 0.23
500 0.18
501 0.16
502 0.18
503 0.18
504 0.18
505 0.16
506 0.17
507 0.16
508 0.14
509 0.15
510 0.12
511 0.12
512 0.12
513 0.12
514 0.12
515 0.16
516 0.16
517 0.16
518 0.16
519 0.15
520 0.14
521 0.14
522 0.13
523 0.07
524 0.07
525 0.07
526 0.07
527 0.06
528 0.06
529 0.07
530 0.08
531 0.09
532 0.1
533 0.1
534 0.1
535 0.11
536 0.12
537 0.12
538 0.14
539 0.16
540 0.15
541 0.21
542 0.24
543 0.25
544 0.32
545 0.34
546 0.35
547 0.37
548 0.41
549 0.41
550 0.48
551 0.52
552 0.52
553 0.59
554 0.6
555 0.56
556 0.57
557 0.54
558 0.49
559 0.44
560 0.43
561 0.38
562 0.36
563 0.35
564 0.3
565 0.3
566 0.26
567 0.25
568 0.19
569 0.2
570 0.22
571 0.22
572 0.26
573 0.31
574 0.37
575 0.45
576 0.49
577 0.5
578 0.57
579 0.62
580 0.64
581 0.64
582 0.64
583 0.6
584 0.59
585 0.6
586 0.53
587 0.5
588 0.43
589 0.37
590 0.31
591 0.29
592 0.3
593 0.27
594 0.3
595 0.36
596 0.42
597 0.47
598 0.51
599 0.53
600 0.57
601 0.63
602 0.66
603 0.65
604 0.64
605 0.63
606 0.64
607 0.66
608 0.64
609 0.63
610 0.58
611 0.57
612 0.51
613 0.49
614 0.46
615 0.4
616 0.32
617 0.22
618 0.17
619 0.12
620 0.1
621 0.07
622 0.03
623 0.03
624 0.03
625 0.08
626 0.11
627 0.15
628 0.18
629 0.25
630 0.33
631 0.41
632 0.52
633 0.59
634 0.67
635 0.73
636 0.78
637 0.82
638 0.85
639 0.87
640 0.85
641 0.85
642 0.75
643 0.68
644 0.61
645 0.58
646 0.49
647 0.42
648 0.34
649 0.26
650 0.24
651 0.21
652 0.2
653 0.12
654 0.11
655 0.08
656 0.07
657 0.06
658 0.08
659 0.09
660 0.11
661 0.11
662 0.12
663 0.13
664 0.15
665 0.16
666 0.18
667 0.19
668 0.22
669 0.26
670 0.25
671 0.24
672 0.21
673 0.19
674 0.16
675 0.15
676 0.09
677 0.05
678 0.05
679 0.05
680 0.05
681 0.05
682 0.07
683 0.07
684 0.08
685 0.1
686 0.11
687 0.21
688 0.27
689 0.35
690 0.38
691 0.42
692 0.41
693 0.46
694 0.46
695 0.38
696 0.33
697 0.26
698 0.21
699 0.19
700 0.19
701 0.13
702 0.13
703 0.12
704 0.12
705 0.16
706 0.16
707 0.17
708 0.24
709 0.31
710 0.35
711 0.4
712 0.41
713 0.47
714 0.5
715 0.55
716 0.57
717 0.56
718 0.59
719 0.58
720 0.55
721 0.45
722 0.43
723 0.41
724 0.33
725 0.29
726 0.24
727 0.27
728 0.29
729 0.29
730 0.27
731 0.22
732 0.23
733 0.21
734 0.24
735 0.25
736 0.3
737 0.33
738 0.35
739 0.36
740 0.35
741 0.34
742 0.31
743 0.29
744 0.29
745 0.28
746 0.3
747 0.29
748 0.3
749 0.3
750 0.32
751 0.33
752 0.35
753 0.43
754 0.49
755 0.54
756 0.58
757 0.62
758 0.65
759 0.65
760 0.66
761 0.66
762 0.67
763 0.66
764 0.68
765 0.67
766 0.65
767 0.68
768 0.66
769 0.64
770 0.65
771 0.7
772 0.71
773 0.74
774 0.75
775 0.76
776 0.78
777 0.75
778 0.66
779 0.59
780 0.58
781 0.55
782 0.52
783 0.45
784 0.39
785 0.4
786 0.45
787 0.49
788 0.51
789 0.51
790 0.49
791 0.53
792 0.56
793 0.56
794 0.59
795 0.56
796 0.56
797 0.55
798 0.57
799 0.55
800 0.54
801 0.52
802 0.55
803 0.59
804 0.62
805 0.7
806 0.76
807 0.82
808 0.85
809 0.89
810 0.87
811 0.88
812 0.88
813 0.88
814 0.88
815 0.87
816 0.85
817 0.83
818 0.76
819 0.7
820 0.65
821 0.62