Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165CTA6

Protein Details
Accession A0A165CTA6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
11-36GGGGKAAKKKKWSKGKVKDKAQHMVTBasic
NLS Segment(s)
PositionSequence
8-30ASSGGGGKAAKKKKWSKGKVKDK
Subcellular Location(s) mito 11, cyto 9, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAASSGGGGKAAKKKKWSKGKVKDKAQHMVTLDKPTFDRIFKEVPTFKFISQSILIERLKVNGSLARVAIQHLERDGLIKRIVHHHGQLIYTRSVGGKDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.25
3 0.32
4 0.34
5 0.42
6 0.51
7 0.6
8 0.71
9 0.76
10 0.79
11 0.83
12 0.89
13 0.9
14 0.91
15 0.88
16 0.84
17 0.82
18 0.72
19 0.65
20 0.55
21 0.51
22 0.43
23 0.42
24 0.35
25 0.28
26 0.27
27 0.26
28 0.26
29 0.22
30 0.21
31 0.17
32 0.2
33 0.2
34 0.25
35 0.26
36 0.25
37 0.29
38 0.29
39 0.26
40 0.26
41 0.25
42 0.23
43 0.19
44 0.19
45 0.15
46 0.19
47 0.19
48 0.17
49 0.17
50 0.15
51 0.15
52 0.14
53 0.14
54 0.11
55 0.12
56 0.12
57 0.12
58 0.12
59 0.11
60 0.12
61 0.14
62 0.13
63 0.13
64 0.12
65 0.13
66 0.11
67 0.14
68 0.14
69 0.14
70 0.15
71 0.16
72 0.17
73 0.23
74 0.28
75 0.3
76 0.31
77 0.33
78 0.33
79 0.34
80 0.37
81 0.34
82 0.3
83 0.27
84 0.25
85 0.21