Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165CBD6

Protein Details
Accession A0A165CBD6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
47-70CMIANKKKIRRLRAPEKKKKDGEABasic
NLS Segment(s)
PositionSequence
52-92KKKIRRLRAPEKKKKDGEAAKKQGRGGRRTGKGLLRSKGPS
Subcellular Location(s) cyto 14, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MDVALAVFKVIWAGSQLARLTAGVAGLTVLVDQVNRLLAGLETTLDCMIANKKKIRRLRAPEKKKKDGEAAKKQGRGGRRTGKGLLRSKGPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.13
3 0.13
4 0.13
5 0.14
6 0.13
7 0.12
8 0.1
9 0.1
10 0.06
11 0.05
12 0.05
13 0.04
14 0.04
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.05
31 0.05
32 0.04
33 0.04
34 0.05
35 0.09
36 0.13
37 0.17
38 0.22
39 0.27
40 0.35
41 0.42
42 0.49
43 0.55
44 0.62
45 0.69
46 0.75
47 0.82
48 0.85
49 0.88
50 0.89
51 0.83
52 0.78
53 0.76
54 0.75
55 0.75
56 0.75
57 0.76
58 0.73
59 0.72
60 0.71
61 0.66
62 0.63
63 0.57
64 0.55
65 0.55
66 0.54
67 0.55
68 0.58
69 0.61
70 0.63
71 0.67
72 0.62