Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165IMR4

Protein Details
Accession A0A165IMR4    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
58-85VCLKPHHPVVRHRRKRRTVNLENYRHAYHydrophilic
NLS Segment(s)
PositionSequence
70-73RRKR
Subcellular Location(s) mito 20, nucl 2, cyto 2, plas 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MFGKWCGLCRLVGGWSLVLHATRLYMPLLRRIVFRRRSAFGGFRRQPRTLHIPNLDMVCLKPHHPVVRHRRKRRTVNLENYRHAYDAHAERRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.14
4 0.13
5 0.11
6 0.1
7 0.08
8 0.08
9 0.07
10 0.09
11 0.09
12 0.11
13 0.12
14 0.19
15 0.22
16 0.22
17 0.25
18 0.29
19 0.37
20 0.41
21 0.46
22 0.44
23 0.43
24 0.46
25 0.46
26 0.48
27 0.45
28 0.49
29 0.48
30 0.5
31 0.52
32 0.51
33 0.48
34 0.45
35 0.48
36 0.41
37 0.43
38 0.37
39 0.34
40 0.34
41 0.34
42 0.3
43 0.21
44 0.17
45 0.14
46 0.12
47 0.12
48 0.14
49 0.18
50 0.22
51 0.27
52 0.37
53 0.45
54 0.56
55 0.66
56 0.73
57 0.79
58 0.84
59 0.9
60 0.92
61 0.91
62 0.9
63 0.91
64 0.91
65 0.88
66 0.84
67 0.78
68 0.69
69 0.58
70 0.48
71 0.39
72 0.36
73 0.37