FuNGI

G2XHH6

Protein Details

Accession

G2XHH6

Localization Confidence

Medium

Confidence Score

12.4

NoLS Segment(s)

Position	Sequence	Protein Nature
55-85	GQERGNDKKQQQQGKKNKQGGRNEWRRQMND	Hydrophilic

NLS Segment(s)

Position	Sequence
62-100	KKQQQQGKKNKQGGRNEWRRQMNDKRKQLGDARQAKRRK

Subcellular Location(s)

nucl 12, cyto 11, pero 4

Family & Domain DBs

InterPro	View protein in InterPro IPR020103 PsdUridine_synth_cat_dom_sf IPR001406 PsdUridine_synth_TruA IPR020097 PsdUridine_synth_TruA_a/b_dom IPR020095 PsdUridine_synth_TruA_C IPR041708 PUS1/PUS2-like IPR020094 TruA/RsuA/RluB/E/F_N
Gene Ontology	GO:0005634 C:nucleus GO:0009982 F:pseudouridine synthase activity GO:0003723 F:RNA binding GO:1990481 P:mRNA pseudouridine synthesis GO:0031120 P:snRNA pseudouridine synthesis GO:0031119 P:tRNA pseudouridine synthesis
KEGG	vda:VDAG_09730 -
Pfam	View protein in Pfam PF01416 PseudoU_synth_1
CDD	cd02568 PseudoU_synth_PUS1_PUS2

Amino Acid Sequences

MASEANPSSESAAAAPAVDTTMDGGSNGTDSAPRAAQPTTGETGSPAAAEGGARGQERGNDKKQQQQGKKNKQGGRNEWRRQMNDKRKQLGDARQAKRRKLDENGNAIDADNEIQEAVVVDPRKANPFSISEIAAEERRPKRKVAVMVGYSGTGYYGLQINWDEKTIEGDLFKAFITAGAISKANADDPKKSSLSRCARTDKGVHAAGNLISLKLIIEDDDIVDKINAHLPDQIRVWGLQRTSNSFSAYQACDSRWYEYLLPTYCLLPSHPDSFLWKKLVESAQEKGYYDDFQSKLADMDGFWAEVEEKAIKPILEQLEPQVRAEVLERIHASEDHPESALKKSALNDAMQVVPPATAVTGEATSAEDTSTIATTGKTKNLGPVDFALRDMKNAYVKAKRAYQVTPERLDQLQAALDQYVGTYNFHNYTIQKSFKDPSAKRHIKSFQVNKTPIQIRDTQWVSIKVHGQSFMMHQIRKMISMATLVVRCATPLTRIKESYGEDRIAIPKAPGLGLLLERPVFEGYSRKAVDSLGREPIDFTKHDDKIQAFKDKEIYQRIFEVEEKENIFHTFFQQVDNFKSDYFLWLTAGGIQAGAIRASKPFSKDDKASNVALVDDEDEDPEGGEG

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.11
2	0.1
3	0.08
4	0.08
5	0.07
6	0.07
7	0.07
8	0.07
9	0.07
10	0.07
11	0.07
12	0.07
13	0.08
14	0.08
15	0.07
16	0.08
17	0.09
18	0.13
19	0.13
20	0.14
21	0.16
22	0.16
23	0.19
24	0.2
25	0.23
26	0.24
27	0.23
28	0.22
29	0.21
30	0.22
31	0.2
32	0.17
33	0.12
34	0.08
35	0.08
36	0.08
37	0.08
38	0.08
39	0.11
40	0.12
41	0.12
42	0.13
43	0.18
44	0.25
45	0.33
46	0.38
47	0.44
48	0.48
49	0.57
50	0.64
51	0.7
52	0.73
53	0.75
54	0.8
55	0.82
56	0.88
57	0.88
58	0.87
59	0.85
60	0.85
61	0.85
62	0.85
63	0.84
64	0.82
65	0.82
66	0.83
67	0.79
68	0.78
69	0.79
70	0.79
71	0.78
72	0.8
73	0.78
74	0.72
75	0.73
76	0.72
77	0.71
78	0.7
79	0.7
80	0.67
81	0.68
82	0.73
83	0.72
84	0.73
85	0.69
86	0.65
87	0.63
88	0.67
89	0.67
90	0.69
91	0.66
92	0.59
93	0.53
94	0.46
95	0.38
96	0.28
97	0.19
98	0.1
99	0.07
100	0.06
101	0.05
102	0.05
103	0.06
104	0.06
105	0.09
106	0.1
107	0.11
108	0.14
109	0.16
110	0.21
111	0.22
112	0.22
113	0.22
114	0.24
115	0.28
116	0.27
117	0.26
118	0.22
119	0.22
120	0.23
121	0.21
122	0.2
123	0.24
124	0.29
125	0.36
126	0.37
127	0.38
128	0.42
129	0.47
130	0.53
131	0.53
132	0.54
133	0.48
134	0.49
135	0.47
136	0.41
137	0.34
138	0.26
139	0.18
140	0.09
141	0.07
142	0.06
143	0.07
144	0.07
145	0.09
146	0.1
147	0.11
148	0.12
149	0.13
150	0.12
151	0.1
152	0.13
153	0.13
154	0.12
155	0.11
156	0.12
157	0.11
158	0.11
159	0.11
160	0.08
161	0.07
162	0.06
163	0.07
164	0.07
165	0.07
166	0.08
167	0.08
168	0.08
169	0.1
170	0.09
171	0.11
172	0.14
173	0.16
174	0.19
175	0.21
176	0.26
177	0.27
178	0.28
179	0.29
180	0.35
181	0.43
182	0.45
183	0.48
184	0.5
185	0.51
186	0.53
187	0.54
188	0.47
189	0.44
190	0.4
191	0.34
192	0.28
193	0.27
194	0.23
195	0.22
196	0.18
197	0.12
198	0.08
199	0.08
200	0.08
201	0.07
202	0.07
203	0.04
204	0.04
205	0.05
206	0.05
207	0.06
208	0.06
209	0.07
210	0.07
211	0.06
212	0.06
213	0.11
214	0.1
215	0.1
216	0.14
217	0.15
218	0.17
219	0.18
220	0.19
221	0.15
222	0.15
223	0.16
224	0.15
225	0.15
226	0.16
227	0.17
228	0.21
229	0.24
230	0.25
231	0.25
232	0.23
233	0.23
234	0.24
235	0.23
236	0.2
237	0.18
238	0.16
239	0.19
240	0.2
241	0.2
242	0.18
243	0.19
244	0.18
245	0.19
246	0.23
247	0.2
248	0.2
249	0.18
250	0.17
251	0.15
252	0.15
253	0.13
254	0.13
255	0.14
256	0.15
257	0.15
258	0.15
259	0.2
260	0.23
261	0.26
262	0.24
263	0.21
264	0.19
265	0.23
266	0.25
267	0.24
268	0.23
269	0.22
270	0.23
271	0.24
272	0.24
273	0.21
274	0.2
275	0.17
276	0.15
277	0.18
278	0.15
279	0.15
280	0.15
281	0.14
282	0.13
283	0.13
284	0.12
285	0.06
286	0.08
287	0.07
288	0.07
289	0.06
290	0.06
291	0.06
292	0.06
293	0.07
294	0.06
295	0.05
296	0.06
297	0.07
298	0.07
299	0.07
300	0.11
301	0.12
302	0.12
303	0.12
304	0.15
305	0.21
306	0.21
307	0.21
308	0.17
309	0.15
310	0.14
311	0.15
312	0.15
313	0.09
314	0.11
315	0.11
316	0.11
317	0.12
318	0.12
319	0.12
320	0.14
321	0.15
322	0.13
323	0.13
324	0.13
325	0.13
326	0.15
327	0.17
328	0.13
329	0.13
330	0.14
331	0.18
332	0.19
333	0.18
334	0.17
335	0.16
336	0.16
337	0.15
338	0.14
339	0.09
340	0.07
341	0.07
342	0.06
343	0.05
344	0.04
345	0.04
346	0.04
347	0.04
348	0.04
349	0.05
350	0.05
351	0.05
352	0.06
353	0.05
354	0.04
355	0.04
356	0.05
357	0.05
358	0.05
359	0.05
360	0.05
361	0.09
362	0.11
363	0.13
364	0.14
365	0.14
366	0.19
367	0.23
368	0.23
369	0.21
370	0.21
371	0.23
372	0.21
373	0.22
374	0.21
375	0.17
376	0.18
377	0.17
378	0.17
379	0.16
380	0.18
381	0.21
382	0.23
383	0.26
384	0.29
385	0.33
386	0.34
387	0.34
388	0.35
389	0.39
390	0.43
391	0.46
392	0.45
393	0.4
394	0.4
395	0.37
396	0.36
397	0.27
398	0.19
399	0.14
400	0.11
401	0.11
402	0.08
403	0.08
404	0.07
405	0.06
406	0.07
407	0.06
408	0.07
409	0.07
410	0.09
411	0.1
412	0.11
413	0.14
414	0.13
415	0.18
416	0.24
417	0.27
418	0.26
419	0.28
420	0.3
421	0.33
422	0.43
423	0.39
424	0.42
425	0.5
426	0.56
427	0.54
428	0.61
429	0.6
430	0.58
431	0.66
432	0.66
433	0.64
434	0.66
435	0.68
436	0.61
437	0.64
438	0.61
439	0.53
440	0.48
441	0.44
442	0.37
443	0.42
444	0.43
445	0.37
446	0.35
447	0.37
448	0.35
449	0.33
450	0.35
451	0.29
452	0.29
453	0.27
454	0.24
455	0.21
456	0.22
457	0.27
458	0.27
459	0.25
460	0.24
461	0.3
462	0.3
463	0.3
464	0.28
465	0.19
466	0.15
467	0.16
468	0.17
469	0.14
470	0.14
471	0.13
472	0.13
473	0.13
474	0.12
475	0.12
476	0.12
477	0.14
478	0.21
479	0.27
480	0.31
481	0.33
482	0.35
483	0.39
484	0.41
485	0.42
486	0.39
487	0.34
488	0.3
489	0.31
490	0.32
491	0.28
492	0.25
493	0.19
494	0.16
495	0.16
496	0.15
497	0.12
498	0.11
499	0.11
500	0.11
501	0.12
502	0.12
503	0.12
504	0.12
505	0.13
506	0.13
507	0.12
508	0.11
509	0.16
510	0.17
511	0.26
512	0.26
513	0.25
514	0.25
515	0.26
516	0.31
517	0.3
518	0.32
519	0.31
520	0.31
521	0.3
522	0.32
523	0.34
524	0.32
525	0.27
526	0.31
527	0.32
528	0.33
529	0.35
530	0.39
531	0.38
532	0.42
533	0.48
534	0.5
535	0.42
536	0.43
537	0.48
538	0.47
539	0.52
540	0.53
541	0.5
542	0.43
543	0.45
544	0.43
545	0.39
546	0.37
547	0.35
548	0.3
549	0.32
550	0.31
551	0.29
552	0.29
553	0.27
554	0.26
555	0.22
556	0.21
557	0.2
558	0.18
559	0.21
560	0.24
561	0.26
562	0.29
563	0.31
564	0.29
565	0.25
566	0.27
567	0.24
568	0.24
569	0.23
570	0.19
571	0.17
572	0.16
573	0.16
574	0.16
575	0.16
576	0.12
577	0.1
578	0.09
579	0.09
580	0.09
581	0.1
582	0.09
583	0.09
584	0.1
585	0.14
586	0.18
587	0.2
588	0.27
589	0.33
590	0.4
591	0.44
592	0.51
593	0.56
594	0.56
595	0.54
596	0.49
597	0.42
598	0.35
599	0.31
600	0.24
601	0.17
602	0.14
603	0.13
604	0.12
605	0.12
606	0.12

G2XHH6

3D AlphaFold-predicted Structure Viewer