Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165EWC8

Protein Details
Accession A0A165EWC8    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
15-37DWLAPKPKEPRGPRERRPSNWPGBasic
NLS Segment(s)
PositionSequence
19-33PKPKEPRGPRERRPS
Subcellular Location(s) mito_nucl 12, nucl 11.5, mito 11.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MDRPLRPRRGSSLFDWLAPKPKEPRGPRERRPSNWPGHHNARPAPFAHARTLPAMPAVPHVPIFGTSLVGSPDRNSPPLPGNKTATTFFDHFHAVSVCFSSPLCSDTKPKVEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.41
4 0.43
5 0.4
6 0.4
7 0.36
8 0.43
9 0.49
10 0.52
11 0.61
12 0.62
13 0.72
14 0.76
15 0.81
16 0.82
17 0.77
18 0.8
19 0.78
20 0.77
21 0.75
22 0.71
23 0.67
24 0.67
25 0.66
26 0.61
27 0.57
28 0.5
29 0.43
30 0.39
31 0.37
32 0.33
33 0.3
34 0.29
35 0.26
36 0.24
37 0.24
38 0.23
39 0.18
40 0.14
41 0.12
42 0.1
43 0.1
44 0.09
45 0.08
46 0.08
47 0.08
48 0.07
49 0.07
50 0.09
51 0.07
52 0.07
53 0.07
54 0.07
55 0.08
56 0.09
57 0.08
58 0.08
59 0.13
60 0.14
61 0.16
62 0.16
63 0.17
64 0.24
65 0.31
66 0.35
67 0.34
68 0.37
69 0.38
70 0.4
71 0.39
72 0.35
73 0.32
74 0.28
75 0.24
76 0.22
77 0.22
78 0.19
79 0.2
80 0.18
81 0.15
82 0.14
83 0.15
84 0.13
85 0.13
86 0.13
87 0.13
88 0.12
89 0.13
90 0.15
91 0.16
92 0.22
93 0.29