Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165E3B0

Protein Details
Accession A0A165E3B0   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-27PAVRCWWHLHHHPRHHPPPLGBasic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, mito_nucl 12.166, cyto_nucl 11.833, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036890  HATPase_C_sf  
IPR001404  Hsp90_fam  
IPR020575  Hsp90_N  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0140662  F:ATP-dependent protein folding chaperone  
GO:0051082  F:unfolded protein binding  
Amino Acid Sequences MSSTLHPAVRCWWHLHHHPRHHPPPLGHGTEIRLYLKEDQLEYLEEKRIKDIVKKHSEFISQQGRLAGLTLSRSTEIRLYLKEDQLEYLEEKRIKDIVKKHSYPCCPCSSPSFPRVPWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.57
3 0.61
4 0.66
5 0.73
6 0.79
7 0.83
8 0.83
9 0.79
10 0.7
11 0.69
12 0.66
13 0.59
14 0.49
15 0.42
16 0.37
17 0.34
18 0.34
19 0.26
20 0.19
21 0.18
22 0.2
23 0.21
24 0.19
25 0.17
26 0.16
27 0.16
28 0.17
29 0.17
30 0.16
31 0.19
32 0.19
33 0.19
34 0.19
35 0.21
36 0.2
37 0.24
38 0.29
39 0.34
40 0.42
41 0.43
42 0.43
43 0.43
44 0.44
45 0.39
46 0.38
47 0.37
48 0.27
49 0.27
50 0.25
51 0.23
52 0.2
53 0.2
54 0.14
55 0.06
56 0.07
57 0.07
58 0.07
59 0.08
60 0.08
61 0.09
62 0.1
63 0.12
64 0.13
65 0.14
66 0.19
67 0.22
68 0.24
69 0.25
70 0.24
71 0.22
72 0.21
73 0.22
74 0.18
75 0.16
76 0.19
77 0.19
78 0.19
79 0.19
80 0.21
81 0.2
82 0.24
83 0.29
84 0.35
85 0.43
86 0.48
87 0.54
88 0.6
89 0.69
90 0.7
91 0.69
92 0.66
93 0.59
94 0.57
95 0.58
96 0.57
97 0.55
98 0.56
99 0.58