Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165IRY5

Protein Details
Accession A0A165IRY5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MRSALRSKCKGCKKPIREAEPAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001781  Znf_LIM  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00412  LIM  
PROSITE View protein in PROSITE  
PS50023  LIM_DOMAIN_2  
Amino Acid Sequences MRSALRSKCKGCKKPIREAEPAVEVKRGKWHWSCFVCEVRSRPIYEDSAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.81
4 0.76
5 0.7
6 0.63
7 0.57
8 0.53
9 0.42
10 0.36
11 0.29
12 0.24
13 0.28
14 0.26
15 0.26
16 0.29
17 0.32
18 0.37
19 0.4
20 0.44
21 0.41
22 0.46
23 0.44
24 0.43
25 0.43
26 0.41
27 0.42
28 0.4
29 0.38
30 0.37